KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010278Help
Entry
AgaP_AGAP010278   CDS       T01036                                 

Definition
AGAP010278-PA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aga00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:aga00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 187 aa AA seqDB search
MSKKFSCIVAVCENRGIGINGDLPWKLKQELKYFSHTTKKVNDADKRNAVIMGRKTYFGV
PESKRPLPERLNIVLTRNAAAYTFPPDVLVCGSLQEALHKLDSTDHGEHIENIWVVGGNS
VYKEAMESDRCHRIYLTEIKKQFDCDAFFPEIPNSFMVIDNDPDTPSGVQEENGIQYVYK
IYENKQQ
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaaagtttagctgcattgttgctgtttgtgaaaatcgtggtattggcattaac
ggagatttaccatggaaactaaagcaggaactaaaatatttttcacatactacgaagaaa
gttaatgatgctgacaaaagaaatgcggttatcatgggaagaaaaacgtacttcggggtc
ccagaaagcaaacgtccattgccggagcgtctaaatattgtgttgacgcgaaatgcggct
gcctatacttttccgccggatgtgttggtttgtggcagcctgcaggaagcattgcacaag
ctggattcaactgaccatggggaacacatagagaacatttgggttgtcggaggtaacagc
gtatataaggaagccatggaatccgatcgttgtcatcgaatctatttgacggaaatcaaa
aagcaattcgattgtgatgcattcttcccagaaatacccaattcttttatggtgattgat
aatgatccagacactccaagtggtgtgcaagaagaaaacggaatacaatatgtatacaag
atatatgagaacaaacagcaatag

DBGET integrated database retrieval system