KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010278Help
Entry
AgaP_AGAP010278   CDS       T01036                                 

Definition
AGAP010278-PA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AgaP_AGAP010278
   00670 One carbon pool by folate
    AgaP_AGAP010278
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AgaP_AGAP010278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 187 aa AA seqDB search
MSKKFSCIVAVCENRGIGINGDLPWKLKQELKYFSHTTKKVNDADKRNAVIMGRKTYFGV
PESKRPLPERLNIVLTRNAAAYTFPPDVLVCGSLQEALHKLDSTDHGEHIENIWVVGGNS
VYKEAMESDRCHRIYLTEIKKQFDCDAFFPEIPNSFMVIDNDPDTPSGVQEENGIQYVYK
IYENKQQ
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaaagtttagctgcattgttgctgtttgtgaaaatcgtggtattggcattaac
ggagatttaccatggaaactaaagcaggaactaaaatatttttcacatactacgaagaaa
gttaatgatgctgacaaaagaaatgcggttatcatgggaagaaaaacgtacttcggggtc
ccagaaagcaaacgtccattgccggagcgtctaaatattgtgttgacgcgaaatgcggct
gcctatacttttccgccggatgtgttggtttgtggcagcctgcaggaagcattgcacaag
ctggattcaactgaccatggggaacacatagagaacatttgggttgtcggaggtaacagc
gtatataaggaagccatggaatccgatcgttgtcatcgaatctatttgacggaaatcaaa
aagcaattcgattgtgatgcattcttcccagaaatacccaattcttttatggtgattgat
aatgatccagacactccaagtggtgtgcaagaagaaaacggaatacaatatgtatacaag
atatatgagaacaaacagcaatag

DBGET integrated database retrieval system