KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010297Help
Entry
AgaP_AGAP010297   CDS       T01036                                 

Definition
(RefSeq) AGAP010297-PA
  KO
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
aga  Anopheles gambiae (mosquito)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AgaP_AGAP010297
Messenger RNA biogenesis [BR:aga03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     AgaP_AGAP010297
   mRNA cycle factors
    P-body specific factors
     AgaP_AGAP010297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 198 aa AA seqDB search
MNIADIEKKMHDVELREESMLKRITEKDKTISKMSNVVEAYERTIAELISEKEILIRNHE
IECDSLKQDNEINAQHLESLEKTFSNLYAKYERMKKNAIKYKENEEKLVEKVVKLEECLR
AQEQRYEKMKCHAMSQLEIANTKIDEAIRNHSQESAKLKAQIKKEELYRISINEQLIQKS
KENEELVKICDELISETN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgctgatatagagaaaaaaatgcatgacgtcgaactaagagaagaaagcatg
ttgaagcgaattactgaaaaagataaaaccatttccaagatgagcaatgtggttgaagca
tatgaacggactatcgccgaattgatatcagaaaaggaaattctcatccgcaatcacgaa
attgaatgcgacagtcttaaacaagataatgaaatcaacgcacaacatttagaatcattg
gagaaaactttctcaaacttgtatgcgaaatatgaacgcatgaaaaaaaatgcaattaaa
tacaaagaaaatgaagagaaactggtggaaaaagttgtgaaacttgaggaatgtcttcga
gcacaagagcagcgatatgaaaagatgaaatgtcatgcgatgagtcaacttgaaatcgca
aataccaaaattgatgaagccattcgtaatcattcccaagaatcggccaaacttaaggct
cagataaaaaaagaagaactatatcgaatttcgatcaatgagcagttgattcaaaaatca
aaagaaaatgaagagttggtgaagatatgtgacgaattaatcagcgagactaattga

DBGET integrated database retrieval system