KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010428Help
Entry
AgaP_AGAP010428   CDS       T01036                                 

Definition
AGAP010428-PA
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:aga00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3L
AA seq 682 aa AA seqDB search
MANEPKVNLEKLFELDPYLKSHEQEIRRRNTEFRGWIKRLNDLEGGLNEFTQGYKYFGLH
IAQDNSVVAREWAPGAKEVYLTGDFNNWQWLATPYEKLAFGKWELKIPPNPDGSCAIKHL
SEIKVIIRKQDGALVDRLSPWAKYVVPPPKELGVNFQQRVWHPPAHEKYMFRHRKPSRPR
ALRIYECHVGIATEEYGVGTYRNFADNIIPRIAKLGYNTIQLMAIMEHAYYASFGYQVTS
FFAASSRYGTPDELKYMVDKAHEHGIFVLLDVVHSHASKNTQDGLNQFDGTNACYFHDGS
RGEHPTWGSRLFNYSEYEVLRFLLSNLRWWRDEYNFDGYRFDGVTSMLYHSRGGEGFSGD
YNEYFGLNVDTEALIYLAIANYFLHEMDPNVITIAEDVSGMPTLCRPTEEGGIGFDYRLA
MAIPDKWIQLLKTKSDEEWNIGNIVHTLTNRRWKESTVAYAESHDQALVGDKTIAFWLMD
KEMYTHMSVVSDPSLIIDRGIALHKMIRLITHSLGGEAYLNFIGNEFGHPEWLDFPRVGN
NDSYHYARRQWHLVDDQLLKYRFLNEFDRAMQHAEEKYHWLDCLPAYVSWKHEDDKVIAF
ERNNLLFLFNFHSTKSFTDYRIGVELAGKYRVVLSSDDAEFGGFNRIDKNVEHHTFPEGW
AGRRNHIQLYLPCRTACILAPQ
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggctaacgaacctaaagttaatcttgaaaagctgtttgagctggatccgtaccttaaa
tcgcacgagcaagaaattcggcgcagaaacaccgaattccgtggatggatcaagcgtttg
aacgacctagaaggtggcctgaatgagttcacccagggctacaaatattttggtttgcac
atcgcccaggacaatagtgttgtagcgcgcgaatgggctcccggtgccaaggaggtgtat
ctaactggagatttcaataactggcaatggttggccacgccgtacgaaaaactagccttc
ggcaaatgggagctgaagatcccaccgaacccggacggttcctgcgctatcaaacatttg
tccgagatcaaagtgatcattcgcaagcaggacggtgcgctggtggatcgcctatcgcca
tgggctaaatatgtagtgccaccgccgaaagagctgggggttaattttcagcaacgtgtt
tggcacccgccggcgcatgaaaagtatatgttccgccaccggaagcctagccggccccgg
gcactgcgtatctacgagtgtcacgttggcatcgcaacggaggagtacggcgtgggaacg
tatcgcaactttgccgacaacatcattccgcgcattgccaagctgggctacaacaccata
caactgatggccatcatggagcacgcgtactacgctagctttgggtatcaggttacgagc
ttctttgctgcctcgagccggtacggtacgccggacgagttgaagtatatggtggataag
gcacacgagcacggcatctttgtgctgctcgacgtggttcattcgcatgcgagcaaaaat
acgcaggacgggctgaatcaattcgatggcacgaatgcttgctacttccacgacggatct
cgcggtgagcatccgacgtggggtagccggcttttcaattattcggaatacgaagtgctt
cggttcctgctttcgaaccttcgctggtggcgcgatgagtacaactttgatggatatcgt
tttgacggtgtcacctctatgctgtaccactcgcgaggtggagaagggttctccggtgat
tacaacgaatactttgggcttaacgtcgacacggaagccctcatctatctggcaatcgcc
aactacttcctgcacgagatggatccgaacgttattacgattgccgaggacgtgagcggc
atgccgacgctctgtcgtccaacggaggagggcggcattgggtttgactaccgtctcgcc
atggccattccggacaaatggatccagttgctgaagacgaaaagcgacgaagagtggaac
attggcaacattgtgcacacgctcacgaatcgccgatggaaggaaagcacggtggcgtac
gcggaatcacacgatcaagcactggttggcgataaaacgatcgctttctggctgatggac
aaagagatgtacacgcacatgtcggtcgtgtccgatccaagccttatcattgaccgtggc
attgcgctgcacaaaatgattcggctgatcacgcacagcctgggcggggaggcttatctg
aacttcataggcaacgagttcggccatcccgagtggttagattttccgcgcgttggcaac
aacgattcgtatcactatgcgcgccggcagtggcatttggtggacgatcagctgctgaaa
taccgtttcctgaacgaattcgaccgcgcgatgcagcacgctgaggagaagtaccactgg
ctcgactgcctgccggcgtacgttagctggaagcacgaggatgataaggtgatcgcgttc
gagcgcaacaatctgctgtttttgttcaactttcactccaccaaaagcttcacggattat
cgcatcggcgtggagctggccggtaagtatcgcgttgtgcttagctccgacgacgccgag
tttggtgggttcaatcgtatcgataagaatgtcgagcatcacacattcccagagggttgg
gccgggcgccggaatcatatccaactgtatctgccctgcagaaccgcctgcattcttgcc
ccacagtag

DBGET integrated database retrieval system