KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010428Help
Entry
AgaP_AGAP010428   CDS       T01036                                 

Definition
AGAP010428-PA
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AgaP_AGAP010428
Enzymes [BR:aga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     AgaP_AGAP010428
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AgaP_AGAP010428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3L
AA seq 682 aa AA seqDB search
MANEPKVNLEKLFELDPYLKSHEQEIRRRNTEFRGWIKRLNDLEGGLNEFTQGYKYFGLH
IAQDNSVVAREWAPGAKEVYLTGDFNNWQWLATPYEKLAFGKWELKIPPNPDGSCAIKHL
SEIKVIIRKQDGALVDRLSPWAKYVVPPPKELGVNFQQRVWHPPAHEKYMFRHRKPSRPR
ALRIYECHVGIATEEYGVGTYRNFADNIIPRIAKLGYNTIQLMAIMEHAYYASFGYQVTS
FFAASSRYGTPDELKYMVDKAHEHGIFVLLDVVHSHASKNTQDGLNQFDGTNACYFHDGS
RGEHPTWGSRLFNYSEYEVLRFLLSNLRWWRDEYNFDGYRFDGVTSMLYHSRGGEGFSGD
YNEYFGLNVDTEALIYLAIANYFLHEMDPNVITIAEDVSGMPTLCRPTEEGGIGFDYRLA
MAIPDKWIQLLKTKSDEEWNIGNIVHTLTNRRWKESTVAYAESHDQALVGDKTIAFWLMD
KEMYTHMSVVSDPSLIIDRGIALHKMIRLITHSLGGEAYLNFIGNEFGHPEWLDFPRVGN
NDSYHYARRQWHLVDDQLLKYRFLNEFDRAMQHAEEKYHWLDCLPAYVSWKHEDDKVIAF
ERNNLLFLFNFHSTKSFTDYRIGVELAGKYRVVLSSDDAEFGGFNRIDKNVEHHTFPEGW
AGRRNHIQLYLPCRTACILAPQ
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggctaacgaacctaaagttaatcttgaaaagctgtttgagctggatccgtaccttaaa
tcgcacgagcaagaaattcggcgcagaaacaccgaattccgtggatggatcaagcgtttg
aacgacctagaaggtggcctgaatgagttcacccagggctacaaatattttggtttgcac
atcgcccaggacaatagtgttgtagcgcgcgaatgggctcccggtgccaaggaggtgtat
ctaactggagatttcaataactggcaatggttggccacgccgtacgaaaaactagccttc
ggcaaatgggagctgaagatcccaccgaacccggacggttcctgcgctatcaaacatttg
tccgagatcaaagtgatcattcgcaagcaggacggtgcgctggtggatcgcctatcgcca
tgggctaaatatgtagtgccaccgccgaaagagctgggggttaattttcagcaacgtgtt
tggcacccgccggcgcatgaaaagtatatgttccgccaccggaagcctagccggccccgg
gcactgcgtatctacgagtgtcacgttggcatcgcaacggaggagtacggcgtgggaacg
tatcgcaactttgccgacaacatcattccgcgcattgccaagctgggctacaacaccata
caactgatggccatcatggagcacgcgtactacgctagctttgggtatcaggttacgagc
ttctttgctgcctcgagccggtacggtacgccggacgagttgaagtatatggtggataag
gcacacgagcacggcatctttgtgctgctcgacgtggttcattcgcatgcgagcaaaaat
acgcaggacgggctgaatcaattcgatggcacgaatgcttgctacttccacgacggatct
cgcggtgagcatccgacgtggggtagccggcttttcaattattcggaatacgaagtgctt
cggttcctgctttcgaaccttcgctggtggcgcgatgagtacaactttgatggatatcgt
tttgacggtgtcacctctatgctgtaccactcgcgaggtggagaagggttctccggtgat
tacaacgaatactttgggcttaacgtcgacacggaagccctcatctatctggcaatcgcc
aactacttcctgcacgagatggatccgaacgttattacgattgccgaggacgtgagcggc
atgccgacgctctgtcgtccaacggaggagggcggcattgggtttgactaccgtctcgcc
atggccattccggacaaatggatccagttgctgaagacgaaaagcgacgaagagtggaac
attggcaacattgtgcacacgctcacgaatcgccgatggaaggaaagcacggtggcgtac
gcggaatcacacgatcaagcactggttggcgataaaacgatcgctttctggctgatggac
aaagagatgtacacgcacatgtcggtcgtgtccgatccaagccttatcattgaccgtggc
attgcgctgcacaaaatgattcggctgatcacgcacagcctgggcggggaggcttatctg
aacttcataggcaacgagttcggccatcccgagtggttagattttccgcgcgttggcaac
aacgattcgtatcactatgcgcgccggcagtggcatttggtggacgatcagctgctgaaa
taccgtttcctgaacgaattcgaccgcgcgatgcagcacgctgaggagaagtaccactgg
ctcgactgcctgccggcgtacgttagctggaagcacgaggatgataaggtgatcgcgttc
gagcgcaacaatctgctgtttttgttcaactttcactccaccaaaagcttcacggattat
cgcatcggcgtggagctggccggtaagtatcgcgttgtgcttagctccgacgacgccgag
tttggtgggttcaatcgtatcgataagaatgtcgagcatcacacattcccagagggttgg
gccgggcgccggaatcatatccaactgtatctgccctgcagaaccgcctgcattcttgcc
ccacagtag

DBGET integrated database retrieval system