KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010485Help
Entry
AgaP_AGAP010485   CDS       T01036                                 

Definition
AGAP010485-PA
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    AgaP_AGAP010485
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     AgaP_AGAP010485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3L
AA seq 604 aa AA seqDB search
CTLLNSIFVIIVSDISSERLHSLKLNHDSTKLTWMVDWPKKEVLFYINNTFDNGKFKTFA
IGFSQRGELSRCDLCVFTSVPKLYQQVHDSYTSRKFDHIFRDTLQNCEVMYMDDNSVAFR
RKFDTCDPQDIVFHTGTMYIVWLRSNALLEWSNNSTIIPKHSTKNQGVLPVQLLRADKIR
IPETGQILKKLDVRLNNVSVPAAETTYWCKIQQLDPWLTNAKHHIVQFEPIIDNEALVHH
MEVFQCIAGNAEIPTYDGPCQNMPASGHLCSKVMALWAMGAGSFTYPREAGLPIGGKDFN
PHIRLEVHFNNPRMLSGYNDSSGMRINVVSKLRRYDAAIMELGLEYTDKMAIPPEQLAFP
LHGYCIAECSKIALPKTGIVVFGSQLHTHLRGVRVLTRHFRGKTELPILNRDDFFSHHYQ
EIRQLRYKPRVLPGDALVTSCYYDTRGYNSTTLGGFAISDEMCVNYIHYYPATELEVCKS
SISENSLYEYFLYMKNIHKQNITSPNGPRSENYRVIDWNQAKANELIDVYVTEPISMQCN
RSNGLRFDGFEWENAPITSFNLAPPDQSKTCSPVKSGIGWFRSLNNGLCDNYGDCIYADT
KLKE
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
tgcactcttttaaattctatttttgtcataattgtttcagacatatcttccgaaagactc
cattctctcaagctaaaccatgattcaactaagctcacctggatggttgactggcccaag
aaggaagttttgttctacataaataatacctttgataatggaaaatttaagacttttgcc
atcggattttcccaacgaggagaactatccagatgtgatctctgtgtgtttacctctgtt
cctaaactttatcaacaggtgcatgactcatacacatcccgaaagtttgatcacatcttc
agagacactctacaaaattgtgaagttatgtatatggatgacaattctgttgcgtttcgt
cgaaaatttgatacttgtgatccgcaagatatcgtatttcatactggtactatgtatatt
gtatggttgcgttctaatgcattgcttgaatggtcaaataattcaactattataccaaaa
cacagtacgaagaatcaaggtgttctaccagtacaactgctaagagctgataagatacgt
attcccgaaactggacagattttgaaaaagttagacgttcgactgaataacgtatctgtc
ccagcggcggaaacaacgtactggtgcaaaatacaacagctagatccgtggctaacgaac
gcaaaacatcacatagttcaattcgagccgataatagacaacgaagcattagttcatcat
atggaagtatttcaatgtatcgcgggcaatgccgaaattccaacctacgacggtccctgc
caaaatatgcccgcatccggtcacctatgctcgaaagttatggcactctgggcgatggga
gctggatcattcacttatccgcgtgaagcaggtcttcccatcggtggtaaagatttcaac
ccacacatccgtctagaggttcattttaataacccaagaatgctgtctggctacaatgat
agctccggtatgcgtatcaatgtggtttcaaagctgcgtcgttacgatgcggctattatg
gaactaggtctagaatatacagacaagatggctattccaccagaacagcttgcttttccg
cttcatggatactgtatagcagagtgctcgaagatagctcttccgaaaacgggaattgtt
gtgtttggttcacagctgcacacccatttacgcggagtacgtgttcttacacggcatttc
cgaggaaaaactgaactaccaatacttaatcgagacgatttcttctcccatcactaccaa
gagatccgacagttacgttacaagcctcgagttcttccgggtgatgcattagtaacttcc
tgttactacgatacgcgtggctacaattctacaacactcggagggtttgcaatcagcgat
gaaatgtgcgtgaattatatacattactatccagcgacagaacttgaagtttgtaaaagt
tccatctcggaaaattcattgtatgaatattttttgtacatgaaaaacattcacaaacaa
aacataacatcgcctaatggacctcgttcagaaaactatcgagtaattgactggaatcag
gccaaagctaacgaacttattgatgtgtacgtaacagagcctatcagtatgcaatgcaac
cgatcaaacggtttgcgtttcgatggatttgaatgggaaaatgcgccaataacatcattc
aatctcgctcctcctgatcaatctaagacgtgctctccagtaaaatcaggtattggatgg
ttcagatcgttaaacaatgggctttgtgataattatggtgattgtatatatgcagacaca
aaacttaaagaatag

DBGET integrated database retrieval system