KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010596Help
Entry
AgaP_AGAP010596   CDS       T01036                                 

Definition
AGAP010596-PA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aga00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3L
AA seq 574 aa AA seqDB search
MASCLRFASARCVLLLLSGLLFVLICDIDRAQGASVYKSPNLDDARFWRRNAETYLKKVL
MYDENRRMIPSVAKNIIIFVGDGMGIASLSTGRIFKGQRAGRSGEEEQLSFDNFPNTGMS
KTYNTDRQVPDSAGTATAMFSGVKTKYGVLGVDYTITETNLEAAKLPSFMDWAQEEGKRT
GIVTTTRVTHATPAACYAHSINRNYECGAKIPVHLKNRIKDIARQMMEDAPGKNLNVVLG
GGRNHFGASMPNHLKPEYQFQGAMEKTCMRTDGRNLVEEWKLRWNGTNAAYAWKTSDLRA
VELDKVDHLLGLFNDDHLSYDTVRDRTPDGEPSLSEMTEAAIKVLQRPDSAGFALMVEGG
RIDHAHHQNHAHLALAEVVELDKAVETALKLVDLDETLIIVTADHSHAMTFNGYPDRGND
ILGFGNRPNATPYETITYANGPGFLQHRWNSSLLSEESTDWATWIKLNQLNRSEVTYKHL
SAFPLPDETHGGEDVAVFASGPGANLVRGTFEQNYIAYVMSYAGCMGPAKRFNLACDDDF
PRTAAKASGAQRAVSSIVLVIASLHAMVSLVGRM
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtgtttgcggtttgcatcggcccggtgcgtgttattgctgttaagtggcctt
ttgttcgtcctaatctgtgatattgatcgtgcacagggtgcttccgtatacaaatcacct
aatctcgacgacgctcgcttttggcgacgcaatgccgaaacctacctcaagaaagtactg
atgtacgatgaaaaccgtcgtatgataccgtcagtggcgaagaacatcatcatcttcgtg
ggcgatggaatgggcattgcctcactatcaaccggacgcatctttaagggccagcgggct
ggtcggtcgggcgaggaggaacagctcagcttcgacaacttccccaacacgggcatgtcg
aaaacgtacaacaccgacagacaggtaccggactctgccggtacagctactgccatgttc
tccggagtcaagacaaagtacggcgtgctgggagtggactacacgatcaccgagacgaac
ttggaggcggccaaattgccctcgtttatggattgggcacaggaggaaggcaagcgaacg
ggtattgtgaccacgacacgcgtcacacatgctacgcccgccgcttgctacgctcactcg
attaatcgaaactatgagtgtggggccaaaattccagtacatttgaagaatcgcatcaag
gacatcgctcgtcagatgatggaggatgcaccggggaagaatctgaacgtcgtgttgggt
ggtggtaggaaccatttcggtgcgtcgatgccaaaccatcttaagccggagtatcaattc
caaggagcgatggagaaaacttgcatgcgaaccgatggacgcaacttggtggaggaatgg
aagctacgctggaatggcacgaatgctgcgtacgcgtggaaaacctccgacctgagagca
gtcgagctggataaggttgatcatctgctgggactgttcaatgacgatcatttgagctac
gatacggtgcgcgatcgtactcccgatggcgagccctcgctgagtgagatgacggaggca
gcaatcaaggttctacagcggccagactcggcagggtttgctctaatggttgaaggcggc
cgaattgatcacgcacatcatcaaaaccatgcccatctagcgttggccgaggtagtggag
ttagataaagcagtagaaactgcgctcaaattggtggatctagacgaaacactcattatc
gtaacggcggatcattcgcatgcgatgaccttcaacggctatccagatcgaggaaacgat
attctaggctttggcaatcgaccgaacgcgactccctacgaaacgataacctacgcaaac
ggaccaggcttcctgcagcatcgctggaactctagcctgctgagcgaggagtcaactgat
tgggccacgtggattaagctgaatcaactcaaccggagtgaagtgacttacaagcatctg
tccgcgttcccgctgccggacgaaacgcacggcggcgaagatgtggctgtgtttgcatct
ggccccggtgctaatcttgtgcgcggcacgttcgaacaaaactacattgcgtatgtcatg
agttacgccgggtgtatgggaccggcaaaacggtttaaccttgcctgcgacgatgatttt
cctcgtacagcagccaaagcgtctggtgctcaacgtgccgtcagcagtattgtgctagtc
attgcctccctgcatgccatggttagtttagtaggacgaatgtaa

DBGET integrated database retrieval system