KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010792Help
Entry
AgaP_AGAP010792   CDS       T01036                                 

Definition
AGAP010792-PA
Orthology
K03953  
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    AgaP_AGAP010792
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3L
AA seq 385 aa AA seqDB search
TGLLGIVCLKANYSSDAPRKLKTTSLAAMKRGTGGRSSFNGIVATVFGSTGFLGRYVCNK
LGKIGSQVIIPYRADHYEAMRLKLVGDLGQVLFHPYDLRDEEAIYKAVKYSNVVINLVGR
DWETKNFTFKDVHVDGARRLARIAREAGVETFVHVSSLNATPNPQPFFTKEGSKFLASKY
YGELAVREEFPDAIVFRPSDIYGQEDRFLRYYAHIWRRQFRAMPLWYKGERTIKQPVYCS
DLAQGIVNAIKDSDSQGQTYQAVGPRRYKLSALVDWFHQVMRKDEKWWGYYRYDLRYDPT
FRMKVLLTELVSPSFPIGDVHTERVEREYVSDEVEKGVPTLEDLGVNLTYMEDQVPWELR
PYRAALYYDAELDEFEKPTPPQYIQ
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
accgggctgctcggtatcgtgtgcctgaaggcgaactacagcagcgatgcaccacgcaag
ctgaagacgaccagcctggcggcgatgaagcgcggcacgggcggccgctcgagcttcaac
ggcatcgtcgcgaccgtgttcggcagcaccgggttcctcgggcgctacgtgtgcaacaag
ctgggcaaaattggcagtcaggtcatcatcccgtaccgggcggatcactacgaggcgatg
cggctgaagctggtcggcgatctcggccaggtgctgttccatccatacgatctgcgcgac
gaggaagcgatctacaaggcggtgaagtactcgaacgtcgtcatcaatctggtcgggcgc
gactgggagacgaagaacttcacgttcaaggatgtgcacgtggacggggcccgtcggttg
gcccgaattgcgcgcgaagccggcgtggagacgtttgtgcacgtgtcgagcctgaacgcg
acgccgaacccgcagccgttcttcaccaaggagggcagcaagttcctggcgagcaagtac
tacggcgagctggcggtgcgggaggagttccccgatgcgatcgtgttccgcccgtcggac
atctacgggcaggaggatcggttcctgcgctactacgcgcacatctggcgccggcagttc
cgcgcgatgccgctgtggtacaagggcgagcgcacgatcaagcagccggtgtactgttcc
gatctggcgcagggtatcgtgaacgcaatcaaggactcggacagccagggccagacgtac
caggcggtggggccgcgccggtacaagctgtccgcgctggtcgactggttccaccaggtg
atgcgcaaggacgagaagtggtggggatactaccggtacgatctgcgctacgatccgacc
ttccgcatgaaggtgctgctgaccgagctggtgtcgccgtcgttcccgatcggcgacgtg
cacacggagcgggtcgagcgggagtacgtgagcgatgaggtggagaagggcgtaccgacg
ctggaagatttgggcgttaatctgacgtacatggaggatcaggttccgtgggaactgaga
ccgtaccgtgccgccctgtactacgacgctgagctggatgagttcgaaaagccaacgcca
ccacagtacatccagtag

DBGET integrated database retrieval system