KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010935Help
Entry
AgaP_AGAP010935   CDS       T01036                                 

Definition
AGAP010935-PA
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AgaP_AGAP010935
Enzymes [BR:aga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     AgaP_AGAP010935
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AgaP_AGAP010935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3L
AA seq 328 aa AA seqDB search
MTSARLHSSIFHPTLRKLQCQDVAIEAHNLMYPLFLVDDDDAVQPIPSMPGVARYGLTTL
LAHLEPLVAKGLQSILLFGVVDKMPKDSTGSGADCATNPVIRALPRLRAAFPELLIACDV
CLCPYTDHGHCGVLTADGLIDNGPSIKRIAEIALAYAQAGAHIVAPSDMMDNRIGAIKEA
LRKGNLENRCSVLSYSVKFASGFYGPFRDAAKSAPAFGDRKCYQLPPGSKGIAKRAAKRD
VEEGADMLMVKPGMAYLDIVKQVKDDYPELPLFIYQVSGEYSMLLNAGQIGAFDLKTVLW
EVLVGMRRAGADCIISYFTPLVLDWLKE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcggcaagactgcacagcagcatattccatccaaccctgcgaaagctccagtgc
caggatgtggccatcgaagcgcacaacctgatgtacccgttgtttttggttgacgacgat
gatgcagtccagcccattccaagcatgccgggagtggcccggtacggtctcaccaccctg
ctggcccacctggaaccgctcgttgcgaagggtctgcaatcgatcctgctcttcggtgtg
gttgataaaatgcccaaggactcgaccggttcgggtgccgattgcgccaccaatccggtg
atacgcgccctgccccgcctgcgggcagccttccccgagctgctgattgcgtgcgacgtc
tgcctctgcccgtacaccgaccacggccactgcggtgtgctgaccgccgacgggcttatc
gacaacgggccaagcattaagcgcatcgccgaaattgccctcgcgtatgcacaggccggt
gcgcacattgttgcaccgtccgacatgatggacaatcgcattggcgcgataaaggaggca
ctcaggaagggcaatctcgaaaaccgttgctccgtcctgtcgtactcggtgaagtttgcg
tccggcttttatgggccgtttcgggatgcggccaaatcggcaccggcgttcggcgaccgg
aagtgctaccagctgccaccgggctcgaagggcatagcgaagcgggctgcgaaacgtgac
gtggaggaaggcgccgacatgctgatggtgaagccgggcatggcctacctcgacattgtg
aagcaagtgaaggacgactatcccgagcttccactgttcatctatcaagtttcgggcgag
tactcgatgctgctgaatgccggccaaatcggtgcctttgatctgaagactgtcctgtgg
gaggtgctggtcggtatgcgccgggccggtgccgactgtatcatttcctacttcacgccg
ctcgtgctagactggctaaaggaatga

DBGET integrated database retrieval system