KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010935Help
Entry
AgaP_AGAP010935   CDS       T01036                                 

Definition
AGAP010935-PA
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:aga00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3L
AA seq 328 aa AA seqDB search
MTSARLHSSIFHPTLRKLQCQDVAIEAHNLMYPLFLVDDDDAVQPIPSMPGVARYGLTTL
LAHLEPLVAKGLQSILLFGVVDKMPKDSTGSGADCATNPVIRALPRLRAAFPELLIACDV
CLCPYTDHGHCGVLTADGLIDNGPSIKRIAEIALAYAQAGAHIVAPSDMMDNRIGAIKEA
LRKGNLENRCSVLSYSVKFASGFYGPFRDAAKSAPAFGDRKCYQLPPGSKGIAKRAAKRD
VEEGADMLMVKPGMAYLDIVKQVKDDYPELPLFIYQVSGEYSMLLNAGQIGAFDLKTVLW
EVLVGMRRAGADCIISYFTPLVLDWLKE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcggcaagactgcacagcagcatattccatccaaccctgcgaaagctccagtgc
caggatgtggccatcgaagcgcacaacctgatgtacccgttgtttttggttgacgacgat
gatgcagtccagcccattccaagcatgccgggagtggcccggtacggtctcaccaccctg
ctggcccacctggaaccgctcgttgcgaagggtctgcaatcgatcctgctcttcggtgtg
gttgataaaatgcccaaggactcgaccggttcgggtgccgattgcgccaccaatccggtg
atacgcgccctgccccgcctgcgggcagccttccccgagctgctgattgcgtgcgacgtc
tgcctctgcccgtacaccgaccacggccactgcggtgtgctgaccgccgacgggcttatc
gacaacgggccaagcattaagcgcatcgccgaaattgccctcgcgtatgcacaggccggt
gcgcacattgttgcaccgtccgacatgatggacaatcgcattggcgcgataaaggaggca
ctcaggaagggcaatctcgaaaaccgttgctccgtcctgtcgtactcggtgaagtttgcg
tccggcttttatgggccgtttcgggatgcggccaaatcggcaccggcgttcggcgaccgg
aagtgctaccagctgccaccgggctcgaagggcatagcgaagcgggctgcgaaacgtgac
gtggaggaaggcgccgacatgctgatggtgaagccgggcatggcctacctcgacattgtg
aagcaagtgaaggacgactatcccgagcttccactgttcatctatcaagtttcgggcgag
tactcgatgctgctgaatgccggccaaatcggtgcctttgatctgaagactgtcctgtgg
gaggtgctggtcggtatgcgccgggccggtgccgactgtatcatttcctacttcacgccg
ctcgtgctagactggctaaaggaatga

DBGET integrated database retrieval system