KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010984Help
Entry
AgaP_AGAP010984   CDS       T01036                                 

Definition
AGAP010984-PA
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    AgaP_AGAP010984
  Replication and repair
   03420 Nucleotide excision repair
    AgaP_AGAP010984
Transcription machinery [BR:aga03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     AgaP_AGAP010984
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3L
AA seq 501 aa AA seqDB search
MSEAKSSQGNSGTTSKGSSSSGSSLITKPANLECKDLEEYLKSRPPEVLEKLYNYPAICL
AVYRELPEIARQFVIRILFVEQPIPQAVVSSWATQVYAKENTSVSQVLTELGVWRSAAYP
GGLAAWELCPTFKKNLKIALLGGGRPWSMSNALDPDQKSRDIDFLDTYAMSRWRCVLHYM
VGAGSSKGMEGEGISPDAVRILLHANLMKRDESDGSPVITRQGFQFLLLDTQAQVWHFML
QYLDTCEARGLNLPECLSMLFQLSFSTLGRDYSSEGLSPGLLTFLQHLREFGLVYQRKRK
EGRFYPTRLAHNITSKNATHATTLAQDQESNATKDKGYIIVETNYRVYAYTDSNLQVALL
GLFTELLYRFPNLVVGVLSRDSVRQAFRGGITAEQIISYLEQHAHPTMLTVEQAINSKSS
LPPTVVDQIKLWENERNRFTYTEGVVYNQFLSQADFITLRDYAQSIGVMIWQNERIRTMV
VTKNGHDDVKKFWKRYSKGGS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggcaaagagcagccaaggtaacagcggcaccaccagcaaaggatcgtcctcg
tccggctcgtcgctcatcaccaaaccggctaatttagaatgcaaagatttggaagagtat
ctgaaatcgcgaccgcccgaggtgctggaaaagctgtacaactaccccgccatctgtctc
gccgtgtatcgcgagctgccagaaatagcgcgccagttcgttataagaattctgttcgtc
gagcaaccgattccacaagcggtcgtgtcctcgtgggcaacacaggtttacgcaaaagaa
aacacatccgtctcgcaggtgctgaccgagctgggcgtatggcggagcgcggcctatccg
ggcgggctggccgcctgggagctgtgcccaacgttcaagaagaacctcaagatcgcactg
ctgggcggcggccggccctggtcgatgtcgaacgcgctcgatccggaccagaagtcgcgc
gacatcgacttcctggacacgtacgccatgtcccggtggcgctgcgtgctgcactatatg
gttggtgccggtagctccaagggcatggagggggagggcatctcgccggacgcggtgcgc
atcctgctgcacgccaatctgatgaagcgggacgagtcggacggcagcccggtcatcacc
cggcagggcttccagtttctgctgctcgacacgcaggcccaggtgtggcactttatgctg
cagtatctcgatacgtgcgaggcgcgcggcctcaacctgcccgagtgtctgtcgatgctg
ttccagcttagcttcagcacgctcggccgggattacagctccgaggggctcagtccgggc
ctgcttaccttcctgcagcatttgcgcgagttcgggctggtgtaccagcggaagcgcaag
gagggccggttttatccgacgcgcctggcgcacaacatcacctcgaagaacgctacccac
gccacgacgctcgcccaggaccaggaatcgaacgcgaccaaggacaagggctacatcatc
gtcgagacgaactatcgcgtgtacgcgtataccgactcgaacctgcaggtggccctgctc
ggcctgttcaccgagctgctgtaccggtttcccaacctggtggtcggtgtgctgtcgcgc
gattccgtccggcaagcgttccggggcggcattacggcggagcagatcatcagctacctg
gagcagcatgcccacccgacgatgctgacggtggagcaggcgatcaacagcaaatcctcc
ctgccgcccacggtcgtcgatcagataaagctgtgggagaacgaacggaaccggttcacc
tacaccgagggcgtcgtgtacaatcagttcctgtcgcaggccgactttatcacgctgcgc
gattacgcccaatcgatcggcgtgatgatctggcagaacgagcgcatccgcacgatggtg
gtcacgaagaacgggcacgacgatgtgaaaaagttctggaaacggtactccaagggtggc
agttag

DBGET integrated database retrieval system