KEGG   Anopheles gambiae (mosquito): AgaP_AGAP011105Help
Entry
AgaP_AGAP011105   CDS       T01036                                 

Definition
AGAP011105-PA
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:aga00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3L
AA seq 275 aa AA seqDB search
MLLNNVLCRSASAAAAATTTRRFCVTGNRSASPCQRTVFLCLPNVQRQHNLQQYLAKAFS
SLNGKMVKQGPRPLVICGPSGSGKSTLLKKLFKEFPDTFGFSVSHTTRKPRPGEENGVHY
HFVSVEEMQGAIEKGEFIETAVFSGNMYGTSKKAVENVQHQGKVCVLDIEIEGVKQIRNS
DRLNPLLVFVNPPSIEELERRLRGRQTETEESLQKRLNTARKEIEYGTEAGNFDVVVQNN
NLKQAYEDLRNFIVRELETQQGQGINVSLNRVFDE
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgttacttaacaacgttctgtgccggagtgcttctgctgctgctgctgctacgacgaca
cgacggttttgtgtgaccgggaaccgctctgcatcaccctgccaaaggactgttttcctc
tgtctgccaaacgtccagcgtcagcacaatctacaacagtatttagccaaagcattttca
agccttaacggaaagatggtaaagcaaggaccgcgtccgctcgttatctgtggcccgtcg
ggctcgggcaagagcacactgctgaagaagctgttcaaggagtttcccgatacgttcggc
ttcagtgtgtcccataccacgcgtaaaccgcgcccgggcgaggaaaatggcgtacattat
cacttcgtctcggtcgaggaaatgcagggcgccatcgagaagggcgagtttatcgagacg
gcggtatttagcggcaatatgtacggaactagcaaaaaggcggtagagaacgtacagcac
cagggcaaggtgtgcgtgctggacattgagatcgagggcgtgaaacagatccgcaactcg
gaccggttaaacccgctgctggtgtttgtgaatccgccctcgatcgaggagctggagcgc
cgattgcgcggccgccagacggaaacggaggaaagcctgcagaagcggctcaataccgcg
cgtaaagaaattgagtatggcacggaagcgggcaatttcgatgtggtggtgcagaacaac
aacctaaagcaggcgtacgaggatctgcgcaactttatcgtccgcgagctggaaacgcag
caaggccaaggtatcaatgttagcttgaaccgtgtgtttgacgagtga

DBGET integrated database retrieval system