KEGG   Anopheles gambiae (mosquito): AgaP_AGAP011105Help
Entry
AgaP_AGAP011105   CDS       T01036                                 

Definition
(RefSeq) AGAP011105-PA
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00230  Purine metabolism
aga01100  Metabolic pathways
Module
aga_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AgaP_AGAP011105
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     AgaP_AGAP011105
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_22 AAA_16 AAA_18 ABC_tran ATPase_2 RsgA_GTPase Rad17 AAA_29 RNA_helicase AAA_23 MMR_HSR1 NACHT AAA_14 Pox_A32 Adeno_IVa2 AAA_17 NB-ARC Septin cobW AAA_21 T2SSE NTPase_1 AAA AAA_24 G-alpha MobB AAA_28 AAA_30 Viral_helicase1 KAP_NTPase FtsK_SpoIIIE Dynamin_N
Motif
Other DBs
NCBI-GeneID: 1270820
NCBI-ProteinID: XP_309541
VectorBase: AGAP011105
UniProt: Q7PSP6
Position
3L
AA seq 275 aa AA seqDB search
MLLNNVLCRSASAAAAATTTRRFCVTGNRSASPCQRTVFLCLPNVQRQHNLQQYLAKAFS
SLNGKMVKQGPRPLVICGPSGSGKSTLLKKLFKEFPDTFGFSVSHTTRKPRPGEENGVHY
HFVSVEEMQGAIEKGEFIETAVFSGNMYGTSKKAVENVQHQGKVCVLDIEIEGVKQIRNS
DRLNPLLVFVNPPSIEELERRLRGRQTETEESLQKRLNTARKEIEYGTEAGNFDVVVQNN
NLKQAYEDLRNFIVRELETQQGQGINVSLNRVFDE
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgttacttaacaacgttctgtgccggagtgcttctgctgctgctgctgctacgacgaca
cgacggttttgtgtgaccgggaaccgctctgcatcaccctgccaaaggactgttttcctc
tgtctgccaaacgtccagcgtcagcacaatctacaacagtatttagccaaagcattttca
agccttaacggaaagatggtaaagcaaggaccgcgtccgctcgttatctgtggcccgtcg
ggctcgggcaagagcacactgctgaagaagctgttcaaggagtttcccgatacgttcggc
ttcagtgtgtcccataccacgcgtaaaccgcgcccgggcgaggaaaatggcgtacattat
cacttcgtctcggtcgaggaaatgcagggcgccatcgagaagggcgagtttatcgagacg
gcggtatttagcggcaatatgtacggaactagcaaaaaggcggtagagaacgtacagcac
cagggcaaggtgtgcgtgctggacattgagatcgagggcgtgaaacagatccgcaactcg
gaccggttaaacccgctgctggtgtttgtgaatccgccctcgatcgaggagctggagcgc
cgattgcgcggccgccagacggaaacggaggaaagcctgcagaagcggctcaataccgcg
cgtaaagaaattgagtatggcacggaagcgggcaatttcgatgtggtggtgcagaacaac
aacctaaagcaggcgtacgaggatctgcgcaactttatcgtccgcgagctggaaacgcag
caaggccaaggtatcaatgttagcttgaaccgtgtgtttgacgagtga

DBGET integrated database retrieval system