KEGG   Anopheles gambiae (mosquito): AgaP_AGAP011152Help
Entry
AgaP_AGAP011152   CDS       T01036                                 

Definition
AGAP011152-PA
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AgaP_AGAP011152
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    AgaP_AGAP011152
Enzymes [BR:aga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     AgaP_AGAP011152
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3L
AA seq 1232 aa AA seqDB search
MSFSIGGTGTSCLAALGEMEQIICQLERGTLIQKFYPRKRPEKKTLMLRRETRQIIWSSV
QTNGRSNYEGSLELREVKEVRPGKKSKDFEKWPEEAKKSEPRKCFVILHGNDFKLRTVSI
VAFSEKEADMWLKGLKYLISDTVSAPYWLQIERWLRREFYLMEANGTASLKDVRSFLPKI
NCKISTAKLNEVFHEVDTRRRNELGFDDFTRLYQRLILPPASLPEYFDGLRMATYSQNGE
TVTLQEFRRFLTKEQQEDEGSPGGGHSEETVAKFINDYIQDPARDVSEPYLRLHEFIDFL
FSRQNEIWDKRCDTVYQDMSRPLAHYWISSSHNTYLTGDQFSSESSVEAYARALRMGCRC
IELDCWDGPDNMPLIFHGHTFTTRIKFMDVIRTIKEHAFITSEYPLILSIEQNCSLTQQR
RMAQAMLEVFGEMLLTQPIDKAEAQLPSPQQLKRKIILKHKKLPENGMLVVDEAGKESAV
LMRGNDESELDIRNTVKNGILYLEDPVDKGWNAHFFVLTQHKLFYTDSQRPDRDADGRDD
EREENGFATNRQSRDGAVLSNDELHFGENWFHGKLSGGREEAEKLLQQFSHLGDGTFLVR
ESVTFVGDYCLSFWRQGKPNHCRIKLKQDKGVTKYYLMENVLFESLYSLIMYYRQNALRS
AEFYITLKEPVPQPNKHETKEWYHQTTTREQSEIVLNQIPQDGAFLVRPSEKGTKAFVIS
FRAHGKFKHCRIRVEGRLYEMGGMEFESLVDLVNFYSKHPLYRKVTLTYPIPREMIRRIN
TMDVSCGPPVLQDPFPGGYGYMDPATVTNENVTVKALYDYKAQRDDELSFCKHAIITNVV
KRGNDWWLGDYGGKRQHYFPANYVQELSAMDDGTLVEEGANEPLMLGSLQKGSLDVHGAV
VEMAYSNHPDIERILRIQNPTMQNVFEVGVQTKELAYEWMCAIKEAAQNASAMENERRKM
ERNSRVAKEMSDLIIYCRSVPFKHHPAAWVFYEMSSFPETKAEKYFLQAETRALFVRYHR
NHLSRVYPKGQRLDSSNYHPTALWNCGSQMIALNFQTPDKPMQLNQAKFRDNGGCGYLLK
PEFMFRDEFDPTDPNTLVGVGEVIVNVRIIGGRNLCKVSRNITSPLVEVEVLGASFDGGI
KHRTRAIADNGLNPIWNEICEFRIANPHFAMIRFEVQDEDMFGEPNFIGQAVFPLGSIRT
GYRSVVLRNKYSEELELATLLVHTSIRPLQTE
NT seq 3699 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagcatcggcggaacgggcaccagctgcctggcggcgctcggcgagatggaa
cagatcatctgccagctcgagcggggcaccctgatccagaagttttacccccgcaaacgg
ccggaaaagaaaacgcttatgctgcgccgcgaaacgcgacagatcatctggtcctcggtg
cagacgaacgggcgcagcaactacgaggggtcgctggagctgcgcgaggtgaaggaggtg
cggcccggcaaaaagtcgaaagactttgagaagtggccggaagaggccaagaagagcgaa
ccgcgcaaatgtttcgtcatcctgcacgggaatgattttaagctgcgcaccgtttcgatc
gtggcattctccgaaaaggaagcggacatgtggctgaaaggactgaagtatctgatctcg
gacacggtgagcgccccgtactggctgcagatagagcgctggctgcggcgcgaattctac
ctgatggaggcgaacggcacggccagcctgaaggacgtgcggtcctttctgccgaagatt
aactgcaaaatatccaccgccaaactgaacgaagtcttccacgaggtggacacgcggcgc
cgcaacgagctcgggttcgacgactttacccgcctgtaccagcggctgatactgccgccg
gcctcgctgccggagtacttcgatggcctgcggatggccacgtacagccagaacggggag
acggtgacgctgcaagagtttcgccgctttctcaccaaagagcagcaggaggacgaggga
agtcccggtggtgggcacagtgaggaaacggtggcgaagttcatcaacgactacatccag
gatccggcacgcgacgtgagcgaaccgtaccttcggctgcatgagtttatcgactttctg
ttttcccgccaaaacgaaatctgggacaagcggtgcgacacggtgtaccaggacatgagc
cgcccgctcgcccactactggatctcgtcgtcgcacaacacctacctaaccggggaccag
ttttccagcgaatcgtcggtcgaagcgtacgcccgggcgctgcgcatgggttgccgctgc
atcgaactggactgctgggacgggccggacaatatgccgctcatcttccacggccacacg
ttcacgacgcgcatcaagtttatggacgtgatacgcacgatcaaggagcacgcgttcatc
acgtccgagtacccgctgatactgtcgatcgagcagaactgctcgctgacgcagcagcgc
cggatggcgcaagcgatgctggaagtgttcggggagatgctgctgacgcaaccgatcgac
aaggcggaagcgcagctaccgtcgccgcagcagctgaagcgcaagattatactgaagcac
aagaagctgccggagaacgggatgctggtggtggacgaggcgggcaaggagtcggccgta
ctgatgcgcggcaacgatgagagcgagctggacatacggaacacggtgaagaacgggatc
ctctacctggaggacccggtggacaagggctggaatgcgcactttttcgtgctgacgcag
cacaagctcttctatacggacagtcagcgccccgatcgtgacgcggatggacgggatgat
gagcgcgaagagaacggattcgccaccaaccgacagtcccgggacggcgcagtgctgtcg
aacgatgagctacactttggcgagaattggttccacggcaagctgtcggggggtcgcgag
gaggcggaaaagttgctgcaacagttttcccacctcggcgatgggacgtttctcgtgcgc
gaaagtgtcaccttcgtgggggactactgtctgtcgttctggcgccagggcaaaccgaac
cactgtcgcatcaagctcaagcaggacaagggtgtgacgaagtactacctgatggagaac
gtgctgttcgaaagtctgtacagcttgatcatgtactaccggcagaatgcgttgcgaagt
gcggaattttacatcacactaaaggaaccggtcccccagccgaacaagcacgagacgaag
gaatggtaccaccagacgaccacgcgcgaacagtcggaaatcgtgctcaaccagataccg
caggatggcgcctttctggtgcggccgagcgaaaagggaacgaaagcattcgttatatcg
tttcgcgcgcacggaaagtttaagcactgccggatccgggtggaaggccgcctgtacgag
atgggaggaatggagtttgaaagtttggtcgatctggtcaacttctactcgaagcaccca
ctgtaccggaaggtgacgctcacgtacccgataccgcgcgagatgatacgccgcatcaac
acgatggacgtaagttgtggtccacctgtgttgcaggacccttttcctggcggctacggg
tatatggatccggccacggttaccaacgaaaacgtgacggtcaaggcgctgtacgactac
aaggcgcagcgggacgacgagctgtcgttctgcaagcacgccatcatcacgaacgtggtg
aagcggggcaacgactggtggctgggcgattacggtggcaagcggcagcactacttcccc
gccaactacgtgcaggagctgagcgcgatggacgacgggacgctggtggaggagggcgcc
aatgagccgctgatgctgggcagcctgcagaagggctcgctggacgtgcatggggcggtg
gtggagatggcgtacagcaaccatccggacattgagcgcatcctgcgcatccaaaacccg
acgatgcagaacgtgttcgaggtgggcgtgcagacgaaggagctggcgtacgagtggatg
tgcgcgatcaaggaggcggcgcagaacgcgagcgcgatggagaacgagcggcgcaagatg
gagcgcaactcgcgcgtcgccaaggagatgtcggatctgatcatctattgccgcagcgtg
ccgttcaagcatcatccggcggcgtgggtgttttacgaaatgtccagcttcccggagacg
aaggcggaaaagtactttctgcaggcggaaacgcgcgccctgtttgtgcgctaccaccgg
aaccatctgagccgggtgtacccgaaggggcagcggctcgactcgtccaactaccatccg
acggcactgtggaactgtgggtcgcagatgattgcgctcaacttccagacgccggacaaa
ccgatgcagctgaatcaggccaagtttcgggacaatggcggatgcgggtacttgctgaag
ccggagtttatgtttcgcgatgagttcgatccgaccgatccgaacacgctggtcggggtg
ggcgaggtgatcgtgaacgtgcgcatcattggcgggcgcaatctgtgcaaggtgagccgc
aacattaccagcccgctggtggaggtggaagtgctgggcgcatcgttcgacggtggcatc
aagcatcgtaccagagcgatagcggacaacgggctgaacccgatctggaacgaaatctgc
gagtttcggatagcgaatccacactttgcgatgatacggttcgaggtgcaggacgaggac
atgttcggcgagccgaactttattggccaggccgtctttccgctcggctcgatccgcacc
ggctaccggagcgtggtgctgcgcaacaagtacagcgaggagctcgagctggccacactg
ctggtgcacaccagcatccggccactgcagacggagtga

DBGET integrated database retrieval system