KEGG   Anopheles gambiae (mosquito): AgaP_AGAP011166Help
Entry
AgaP_AGAP011166   CDS       T01036                                 

Definition
AGAP011166-PA
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:aga03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3L
AA seq 327 aa AA seqDB search
MSDVELSNIDHLIAMLLEVRGARPGKNVQLSETDIRLLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGSFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKMWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTNGYGENDRGVSFTFGVDIVGKFLTKHD
FDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPAD
KRKFQYGGLNSGRPVTPPRSYSKNKKK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgtagagttatcaaacatagaccacctcattgcgatgcttttagaagttcgc
ggtgcaaggccagggaaaaatgtacaactgtcggaaacggatatacgtctgctatgcctg
aagtcgagggaaatctttctctcccaaccgatactgctcgagctggaggcaccgttaaaa
atctgcggtgacatccatggtcagtattatgacttgctgcgtttgttcgagtacggcagc
ttcccgcccgagtcgaactatctgttcctgggcgattacgtcgaccggggaaagcagtcg
ctcgagacgatctgcctgctgctggcgtacaaaatcaagtatccggagaacttcttcttg
ctgcgcggcaatcatgagtgcgccagtatcaatagaatatacggattctacgatgagtgc
aagcggcgctacaacatcaagatgtggaaaacgttcaccgactgcttcaactgtctgccg
gtggccgcgatcgtggatgagaagattttctgctgccacggcggcctcagcccggacctg
cagtcgatggaacagatccggcgcatcatgcgacccacagacgtgccggaccagggcctg
ctgtgcgatctgctgtggtccgatccggacaaggacacgaacggctacggcgagaacgat
cgtggcgtcagcttcacgttcggcgtggatatcgtgggcaagtttcttaccaagcatgac
tttgatctaatctgtcgagcgcatcaggtggttgaggacgggtacgagttctttgccaag
cggcagctggtaaccctcttctctgctcccaactattgtggagagttcgataatgccggt
gcaatgatgtccgtcgacgatacgttgatgtgctcgttccaaatcctgaagccagccgat
aaacgtaagttccaatatggtggcctcaactccggacggccagttacaccaccgagaagc
tatagtaaaaacaaaaagaaataa

DBGET integrated database retrieval system