KEGG   Anopheles gambiae (mosquito): AgaP_AGAP011300Help
Entry
AgaP_AGAP011300   CDS       T01036                                 

Definition
AGAP011300-PA
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AgaP_AGAP011300
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     AgaP_AGAP011300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3L
AA seq 321 aa AA seqDB search
MGLTVNQVMPVAIGVVVVVVGAAIANYLLNGKKGKSSSSSSASAKGSAGKEPKTLLDPQE
KYMLPLIEKEEISHDTRRFRFGLPSEKHILGLPIGQHIHLSATINDELVIRAYTPVSCDD
DHGYVDLVVKVYKKNVHPKFPDGGKMSQYLEGMSIGDKIAFRGPSGRLQYLGNGRFSIKK
LRKDPAQIYEATQVGLIAGGTGITPMLQLIREVLKHSDKDKTKLSLIFANQTEDDILLKP
ELDDLAARYPDQFKLWYTLDRPKPEWTQGKGFVTDEMIKERLFEPSSNSLVLMCGPPPMV
NYACIPALEKLGYPTERTFAY
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgggcctaactgtaaatcaggtaatgccggttgcgatcggcgtggtggtcgtagtggtc
ggtgccgccatcgccaactacctgctgaacggcaagaagggcaaatcgtcctcctcctcc
tccgcctccgccaagggcagcgctgggaaggaaccgaaaacgctgctcgatccgcaggag
aagtatatgctgccactgatcgagaaggaggaaatttcgcacgatacgcgccggttccgg
tttgggctgccgagcgaaaagcacatcctgggactgccgatcggtcagcacattcatctg
tccgccaccatcaacgacgagctggtgattcgtgcgtacacgccggtttcgtgcgatgac
gaccacgggtacgtcgatctggtggtgaaggtgtacaagaagaacgtccacccgaagttc
ccggacggtggcaagatgtcgcagtacctggagggcatgagcatcggcgacaagattgcg
ttccgcggtccgtccggccggctgcagtacctcggcaatgggcggttctcgatcaagaag
ctgcgcaaggatccggcccaaatctacgaagcgacgcaagtgggcctaattgcgggtgga
actggaatcactccgatgcttcagctgatccgtgaagtactgaaacattccgacaaggac
aagaccaagctgtcgctcatttttgccaatcagaccgaagacgacatcctgctgaagccc
gagctggacgatttggctgcccgctatcccgaccaattcaagctgtggtacacgctcgat
cggcccaagcccgagtggacccagggcaagggtttcgtgacggacgagatgatcaaggag
cgactgttcgagccctcgtcaaactcgctcgtgctaatgtgcggtccaccaccgatggtg
aactatgcctgcattccagcactggaaaagctgggctatccgacggagcgcacctttgcc
tattaa

DBGET integrated database retrieval system