KEGG   Anopheles gambiae (mosquito): AgaP_AGAP012113Help
Entry
AgaP_AGAP012113   CDS       T01036                                 

Definition
AGAP012113-PA
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AgaP_AGAP012113
Peptidases [BR:aga01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   AgaP_AGAP012113
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3L
AA seq 228 aa AA seqDB search
MDVWLPLESNPEVLSNYMVNLGVSPLWSIVDIYGMDDELLDMVPKPVKSLIFLFPCSKAH
EEFRAKQDEELKDKNVEHPKSLFFTRQFVHNACGTIAVIHAILNNPDIEVTEGSVLKKYL
DSAKDLSPVERGELLNKSEEFKATHEQNAQQGQTATPNINDTVYHHFIAFVQVDGTLYEL
DGRKNFPVAHGPTTPETLLKDSIKVCKQFIELDPSEVRFTLLGLVPTQ
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggatgtctggctacccttggaatctaacccggaggtgctgtcgaactatatggtgaat
ttgggcgtttcgccgctctggagcatcgtcgatatctatggaatggacgatgagctgctg
gatatggtgccgaaaccggtcaagtcgttgatctttctgtttccctgctcgaaggcgcac
gaagagttccgcgcgaagcaagacgaggagctgaaggacaaaaacgtggagcatccgaag
agtttgttcttcacgcgacagttcgtgcacaacgcgtgcggtacgattgcggtgattcac
gccatcctgaacaacccggacattgaggtcaccgagggcagcgtgctgaagaagtatctg
gacagtgccaaagacctgtcgcccgtcgagcgtggcgagctgctgaacaagagcgaagag
ttcaaggcgacgcacgagcagaacgctcagcagggccaaaccgccacacccaacattaac
gacacggtgtaccatcactttatcgcgttcgtacaggtggacggcacgctgtacgagctg
gacggccgcaagaacttcccggtggcgcacggaccgaccacgccggagacgctgctgaag
gactcgattaaggtgtgcaagcagttcatcgaactggatccttccgaggtgcgcttcacg
ctgctcggcctggtgccgacccagtga

DBGET integrated database retrieval system