KEGG   Anopheles gambiae (mosquito): AgaP_AGAP012119Help
Entry
AgaP_AGAP012119   CDS       T01036                                 

Definition
AGAP012119-PA
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
aga  Anopheles gambiae (mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
Position
3L
AA seq 527 aa AA seqDB search
KRARKMGDAGCVHFATYVKEYGYEPYSYVHGYFSACVNKEARLRKALSCLCYKCGSSGPQ
LYCCLHCIYFACKGAHITEHYKHTKHFMALELCYGMLYCYQCRDFIYHSKCQTIAERHLW
LEARSLDKSLSWRPWSPSRLEIELLLKNPKRRHVTALTSIGLRGLLNLGSTCFMNCIVQA
LIHTPLLRDYFLAELHECTAKTAAKCLVCEVSRLFQEFYSGARGPLSLHRLLHLIWNHAR
HLAGYEQQDAHEFFIATLDVLHRHCKTGSNYLQQQAEPNQTQCNCIIDQIFTGGLQSDVV
CQACNGVSTTIDPFWDISLDLGESSNGQGGYGGPPRSLIDCLERFTRAEHLGSSAKIKCN
KCNSYQESTKQLSMRTLPIVASFHLKRFEHSSLIDKKISTFISFPAELDMTPFMSQIMSD
QQQQQQQQQSAVPHSPSSSSSNFNERTGGANGSSTGTSLNSDSTARLPVDKSTTDFRYSL
YAVINHVGTLDAGHYTAYVRHQKDIWVKCDDHIITTATLQQVLDSEG
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
aagcgggcgcggaaaatgggcgatgccggatgtgtacactttgcgacgtacgtgaaggag
tacgggtacgagccgtacagctacgtgcacgggtacttcagtgcgtgcgtcaacaaggag
gcccggctgcggaaggccctctcctgcctgtgctacaagtgtggtagctccggtccgcag
ctgtactgctgcctgcactgcatctacttcgcctgcaagggcgcccacattaccgagcac
tacaagcacacgaagcacttcatggcgctggaactgtgctacggcatgctgtactgctac
cagtgtcgggactttatctaccacagcaaatgccagacgatcgccgagcggcacctctgg
ctggaggcgcgcagtctcgacaaaagcctgtcctggcgcccgtggagtccctcgcggctc
gaaatcgagctgctgctgaagaaccccaagcgccggcacgtaaccgcactcaccagcatt
gggctgcgcgggttgctgaatctcggctcgacctgcttcatgaactgcatcgtgcaggcg
ctcatccatacgcccctgctgcgcgactacttccttgccgagctgcacgagtgtacggcg
aaaacggccgccaagtgtttggtgtgtgaagtgtcgcggctgtttcaggaattttactcc
ggcgcccggggtccactgtcgctgcaccggttgctgcatctgatctggaaccatgcgcgg
catttggctgggtacgagcagcaggacgcgcacgagttcttcatcgccacgctggatgtg
ctgcatcggcactgcaaaaccggctcgaactatcttcagcagcaagcggagccaaaccag
acacagtgcaactgtattattgatcagatcttcaccggcggtctgcagagtgatgtcgtg
tgccaggcgtgcaacggtgtctcgaccacgatcgatccgttctgggacatttcgctcgat
ctgggcgaatcgtccaacgggcagggtgggtacggtggaccgccccggtccctgatcgac
tgtctggagcgattcacccgggcggagcatctcggctcgagtgcaaagatcaaatgcaac
aagtgcaacagctaccaggagtcgaccaagcagctgtccatgcgcacgttaccaatcgtc
gccagcttccatctcaagcgcttcgaacactctagtctgatcgataagaaaatttccacc
tttatctcattccctgccgagctcgatatgacaccgtttatgtcacagataatgtctgac
cagcagcagcagcagcagcaacagcaatcggccgttcctcattcaccgtcgtcctcgtcg
tcgaatttcaacgagcgaactggtggagcaaacggttcctctaccggcacgagtttaaac
agtgactcgacggcacgcctgccggtggacaagagtacgaccgattttcgctattcgctg
tacgccgtcatcaatcacgtcgggacgctcgatgcgggccactacacggcgtacgtgcgc
caccagaaagacatttgggtcaagtgcgatgaccacattataaccactgccacactccag
caggttttggacagcgaagggtaa

DBGET integrated database retrieval system