KEGG   Anopheles gambiae (mosquito): AgaP_AGAP012126Help
Entry
AgaP_AGAP012126   CDS       T01036                                 

Definition
(RefSeq) AGAP012126-PA
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AgaP_AGAP012126
Enzymes [BR:aga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AgaP_AGAP012126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Abhydrolase_6 FSH1 DUF2974 Abhydrolase_1 Abhydrolase_3 Peptidase_S9 Lipase_3 DLH Esterase
Motif
Other DBs
NCBI-GeneID: 1280553
NCBI-ProteinID: XP_320405
VectorBase: AGAP012126
UniProt: Q7PZW9
Position
3L
AA seq 219 aa AA seqDB search
MAAAPVIIPSVAKHTSTLIFLHGLGDTGHGWATSMGALRTPDMKVICPTAPNMPVTMNGG
FRLNSWFDLKSISISDPEDEEGIKKATRYVHELIQSEMKAGILSNRIMLGGFSQGGALAL
YAGLTFAEPLAGVMALSCWLPLHKSFPSVRKCPDTVPVLQCHGDCDPIVFYKFGQLSSSV
LKSFMKNSHFQTYQGLGHSSCDAELSDMKKFIDDHVPRQ
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgcacccgttatcattccatcggtcgcgaagcatacctcgacgctaatcttc
cttcatggccttggcgataccggccatggatgggccacatcgatgggagcgctccgtacg
cccgacatgaaggtgatctgcccgaccgcaccgaacatgccggtaacgatgaacggcggc
tttcggctgaactcgtggttcgacctgaagtccatctcgatcagcgacccggaggacgag
gagggcatcaagaaggcaacccggtacgtgcacgagctgatccagagcgagatgaaggcg
ggcattttgtcgaaccggatcatgctcggcgggttctcgcagggtggtgcgctcgcgctg
tacgccggcctgacgttcgccgaaccgctggccggtgtgatggccctgtcctgctggctg
ccgctgcacaaaagcttcccgagtgtgcgaaagtgcccggatacggtgccggtcctccag
tgccacggtgactgtgatccgatcgtgttctacaagtttggtcaattatcgtccagtgtg
ttgaagtcgttcatgaaaaactcgcactttcaaacgtaccagggactggggcacagttcc
tgcgatgccgaattgagcgacatgaagaaattcatcgacgatcatgttcctcgtcagtga

DBGET integrated database retrieval system