KEGG   Anopheles gambiae (mosquito): AgaP_AGAP012140Help
Entry
AgaP_AGAP012140   CDS       T01036                                 

Gene name
EIF3B_ANOGA
Definition
AGAP012140-PA
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
aga  Anopheles gambiae (mosquito)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:aga03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3L
AA seq 683 aa AA seqDB search
MAKKKGEEQDFEEEPNFDDPEGFVDDVSDEELLGDFLRQKPCESDGVENVIVVDNIPVVG
AARFPKLKGIIEKIFKNAGTIVNVHYPKDEEDNTKGYAFVEYKNQESAEEAVKSLNNYRL
DKHYTLLVNRFADFQKYSDIPKEWSPPQPQPYKVQNDLYNFLLEADAQDQFCVVSETVPG
SVQVQFCQNTQPEPTELLKRERFTDTYVKWSPKGTYIVTFHKQGVVVWGGSSFVKVNKFA
HSNAQFVDISPCEQYLVTYGPNGQKIVIWDIRTGAEKRTFVSDGMSNASMLRWSHDDRYV
ARLVDSQIQIYDTTTFFLLDMKSIRVEGIRNFSWSPTDNIIAYWVAEEVDVPAKVTLMAI
PKKTELRTKNLFNVADCKIHWQKSGDYLCVKVDRFSKSKKEKKDKKDSDVKFLGMFYNFE
IFHMREKDIPVDSVEVKETILAFAWEPVGSKFSIIHGEPSSANVSFYETNKGQEPVLVKK
LEKKVCGHLFWSPRGQFIVLANLQMGTFEFVDTNDFSIMKTGDHYRASEVEWDPTGRYVV
TGTSGKAKEDQGYYMWSFQGRILKRVNLKNFMLFLWRPRPPTLLSDAKQKEILKNLKKYY
SQFESKDRLRMTRASKELIEKRAKLREQFTEYRSKRVKEWEDQKKRRMQLRNNVDTDTLE
ADPDNVEEEIVEILVREDTTVIE
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaaagaagggagaagagcaggactttgaggaggagcccaactttgacgatccg
gagggattcgtggacgatgtatcggacgaggaactgcttggagacttcctgcggcagaag
ccgtgcgaatcggacggcgttgagaatgtgattgtcgtggacaacattccggtcgtcggt
gcggcccgcttccccaagctgaagggcatcatcgagaagatcttcaagaatgccggcacg
atcgtgaacgtccactacccgaaggacgaggaggacaacaccaaggggtacgcgttcgtc
gagtacaagaaccaggagagcgcggaggaggcggtcaagtcgctgaacaactaccggctg
gacaagcactacacgctgctggtgaaccggttcgccgacttccagaagtactcggacatc
ccgaaggaatggtccccgccccagccgcaaccgtacaaggtgcagaacgacctgtacaac
ttcctgctggaggcggacgcccaggaccagttctgcgtggtgtcggaaacggtgcccggc
tcggtgcaggtacagttctgccagaacacgcagccggaaccgacggagctgctcaagcgc
gagcggttcaccgacacgtacgtcaagtggtccccgaagggtacgtacatcgtgacgttc
cacaagcagggtgtcgtcgtgtggggcggctcgagcttcgtcaaggtgaacaagttcgcg
cacagcaacgcacagttcgtggacatttcgccctgcgagcagtatctggtgacgtatggc
ccgaacggccagaagatcgtcatctgggacatccgcaccggggcggagaagcgcacgttc
gtgtcggacggcatgtcgaacgcgtccatgctgcgctggtcgcacgatgaccggtacgtg
gcccggctggtcgacagccagatccagatctacgacacgaccaccttcttcctgctcgac
atgaagtcgatccgggtggagggcatccgcaacttcagctggtcgccgaccgacaacatc
atcgcctactgggtcgcggaggaggtggacgtgccggcgaaggtgacgctgatggcgatc
ccgaagaagacggagctgcgcacgaagaacctgttcaacgtggccgactgcaagatccac
tggcagaagtcgggcgactacctgtgcgtgaaggtggaccggttctccaagtcgaagaag
gagaagaaggacaagaaggactcggacgtgaagttcctcggcatgttctacaactttgag
atattccacatgcgcgagaaggacataccggtggattcggtcgaggtgaaggaaacgatc
ctggcgttcgcctgggagccggtcggctcgaagttctccatcatccacggcgagccgtcg
tccgccaacgtgagcttctacgagacgaacaagggccaggagccggtgctggtgaagaag
ctggagaagaaggtgtgcggccacctgttctggtcgccccggggacagtttatcgtgctg
gccaacctgcagatgggcacgttcgagtttgtcgacacgaacgatttcagcatcatgaag
acgggcgaccactaccgtgcctcggaggtggagtgggacccgaccggtcggtacgtcgtg
acgggcacttccggaaaggctaaggaagaccagggctactacatgtggtcattccagggg
cgcatactgaagcgcgtcaatctgaagaacttcatgctgttcctgtggcggccgcgccca
ccgaccctgctgtcggacgccaagcagaaggagattctcaagaacctcaagaagtactac
tcgcagttcgagagcaaggaccgtttgcgtatgacgcgcgcatccaaggagctgatcgag
aagcgtgccaagctgcgcgagcagttcaccgagtaccgatcgaagcgcgtcaaggagtgg
gaggaccagaagaagcgtcgcatgcagttgcgaaacaacgtcgacacagatacgctggag
gctgatccagataatgtagaggaggaaattgttgaaatacttgtacgtgaagataccacc
gtcatcgagtaa

DBGET integrated database retrieval system