KEGG   Anopheles gambiae (mosquito): AgaP_AGAP012189Help
Entry
AgaP_AGAP012189   CDS       T01036                                 

Definition
(RefSeq) AGAP012189-PA
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     AgaP_AGAP012189
Peptidases [BR:aga01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   AgaP_AGAP012189
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   AgaP_AGAP012189
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
VectorBase: 
UniProt: 
Position
3L
AA seq 407 aa AA seqDB search
LPFKRCLKSVYLITFRSLPTSRIGRCTCAVAVLLFLVGFVILPIIFKYSYALQKSILFLT
FITYPPNLDLKRPEKSGLYATRNFYVNHHDHEEDLEVNVAVWHVLPLDLVRRYAKELHVD
EVSGQRGSSRSIVADEKHHAGDRYKGIEKVLRSDGFQLTDEKHQRDLFEETLRATTNDVV
LYLHGNTASRGAPHRVELYQMLRALNYHVIAIDYRGYGDSANLSPSELGVVYDALAVYQY
ITSITNNPVYLWGHSLGTGVSTHLLSLLTEMSLPGPKAVVLESPFNNIKEEICAHPFSKL
YRHLPWFDYLISRPMYKNKLRFESDQHIAEFRQPVLILHAEDDLVVPFELGYKLYRKALD
TRGKSWGPIEFHRFEKSSHYGHKYICRAPNLPEIIVRFFHAYRDAQY
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
cttccatttaaaaggtgtttaaagagtgtgtatctaatcacgtttcgttcgcttcctact
tccagaatcggtcgatgtacgtgtgcggttgcggtgctgctatttctcgtcgggttcgtc
atactaccgatcatcttcaagtattcgtacgcactccagaaaagcatcctctttctcacc
ttcattacctatcccccgaacctggacctgaagcggccggaaaagagtggcctgtacgcg
acgagaaacttctacgtcaaccatcacgaccacgaggaggacctcgaggtgaacgttgcc
gtgtggcacgtgctgccgctcgatttggtgcgccgctatgcaaaggaattgcacgtcgac
gaggtaagcgggcagcgtggcagcagccgatccatcgttgccgatgaaaaacatcacgcc
ggtgatcgttacaaagggatcgaaaaagtgctgcgctcggacgggtttcagctaaccgat
gagaaacaccagcgcgacctgttcgaggagacgctgcgggccacgacgaacgatgtggtg
ctgtacctgcacggaaatacggcatcgcgcggcgccccgcaccgggtcgagctgtaccag
atgctacgggcgcttaactatcacgtgatagcgatcgactaccgtgggtacggtgattcg
gccaacctgtcgccgtccgagctgggcgtcgtgtacgatgcgctggccgtgtatcagtac
atcaccagcatcaccaacaatccggtctacctgtggggccattcgctcggaacgggcgtt
tccacccatctgctgtcgctgctgaccgagatgagcctgcccgggccgaaagcggtcgtg
ctggagagtccgtttaacaacatcaaggaagagatatgtgcccatccattttcaaagtta
taccgtcacctgccatggttcgactacctgatctccagaccaatgtacaagaataagctg
cgcttcgagtccgaccagcatattgccgagttccgccagccggtgctgatactgcacgcg
gaggacgatctcgtggtgccatttgaattaggctataagctttaccgcaaagcgctagac
acgcggggcaaatcgtggggcccgatcgagttccatcggttcgagaagagcagccactac
ggccacaagtacatctgccgggcgccgaatctgcccgagattattgtgcgctttttccac
gcgtaccgcgacgcacaatactga

DBGET integrated database retrieval system