KEGG   Anopheles gambiae (mosquito): AgaP_AGAP012229Help
Entry
AgaP_AGAP012229   CDS       T01036                                 

Definition
AGAP012229-PA
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
aga  Anopheles gambiae (mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3L
AA seq 445 aa AA seqDB search
KDELVIGEEYMVQRQDGSWHLAQLIQSRQNPSDPKQLEYYIHYEGLNRRLDQWVTRDRIS
SESMPGGSPTGATARKSPLGSNTANAKDRFSGLKPGSKEAGTLLMGGTDHIASSLDGGDT
DRKITRNQKRRHDEINHVQKTYADMDPTTAALEKEHEAITKVKYIDKLRIGKYEIDTWYF
SPYPEEYGKVGTMYVCEYCLRYMRLAKTLKEHKAVCTRRQPPGSEIYRKGTLSIFEIDGK
DHRFYCQTLCLMAKLFLDHKTLYYDVDPFYFYVLCEIDREGQHIVGYFSKEKESPEGNNV
ACILILPPYQRKGYGKLLIGFSYELSRLEGVIGSPEKPLSDLGKLSYRSYWAYTLLKLIK
DYRTTTIKELSELSGITPDDIIYTLQSMNMVKYWKGQHVICVTMKQIQEHLQMPQFKKPK
LMVDPAYLKWTPQKRNNPAKQIKKN
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
aaagatgagctggttattggagaggagtacatggtacagcggcaggatggttcgtggcat
ttggcacagttgatacaatcgcgacagaatccctcagacccgaagcagctggagtactac
atccactacgaaggtctcaaccggcggctagatcaatgggtgacgcgggatcgaatatcg
agcgaaagcatgccgggcggcagtccgaccggggcgacggcaaggaaaagtccactcgga
tcgaacacagccaatgcgaaggatcgcttcagcgggctgaagccgggctcgaaggaagcc
ggtacgctgctgatgggcgggacggatcacatcgcatccagcctggacggtggcgatacg
gatcgcaagatcacgcgcaaccagaagcgacgccacgatgagatcaatcacgtgcagaaa
acgtacgccgacatggatccgaccacggcggcgctggaaaaggagcacgaagcgatcacg
aaggtgaagtacatcgacaagctgcgcatcgggaagtacgagatcgacacgtggtacttt
tcgccgtacccggaagagtacggcaaagtcggcacgatgtacgtgtgcgagtactgtctg
cggtacatgcggctggccaaaacgctgaaggagcacaaggccgtctgcacgagacggcag
ccgccgggcagcgagatctaccggaagggcacactgtccatctttgaaatcgacggcaag
gaccaccggttctactgccagacgctttgtctgatggcgaagctgttccttgaccacaaa
acgctttactacgatgtggatccattctacttctacgtgctgtgcgagatcgaccgcgaa
gggcagcatatcgtggggtacttctccaaggagaaggaatcgcccgagggcaacaatgtc
gcgtgcattctcatactgccgccctaccagcgcaagggctacggcaagctgctgatcggg
ttcagctacgaactgtcacgtctggagggagtgatcggcagtccggaaaagccgctctcc
gatctgggcaagctgagctatcgcagctactgggcgtacacgctgctgaagctgatcaag
gactaccggacgacgacgattaaggagctgagcgagctgtccggcatcacgccggacgat
atcatctacacgctgcagtcgatgaacatggtcaagtactggaagggccagcacgtgatt
tgcgtgacgatgaagcagatccaggagcatctgcagatgccacagttcaagaagccgaag
ctgatggtggacccggcgtacctcaagtggacgccccagaagcgcaacaacccagcgaag
cagataaagaaaaattag

DBGET integrated database retrieval system