KEGG   Anopheles gambiae (mosquito): AgaP_AGAP012295Help
Entry
AgaP_AGAP012295   CDS       T01036                                 

Gene name
CYP9L1
Definition
AGAP012295-PA
Orthology
K15003  
cytochrome P450, family 9 [EC:1.14.-.-]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.-  Acting on paired donors with incorporation of molecular oxygen
    1.14.-.-  
     AgaP_AGAP012295 (CYP9L1)
Cytochrome P450 [BR:aga00199]
 Cytochrome P450, animal type
  CYP9 family
   AgaP_AGAP012295 (CYP9L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3L
AA seq 533 aa AA seqDB search
MEINLMYVIGIVSVLVALYVYLTHNNDFFKKYPIPCLPVEPLFGSSRQFLLKKISFSEFV
RSNYERFPNAKMYGMFEMFTPMFVIRDPELIKQITVKDFDHFINHRPLMKADNSSNSTAM
FSKILFNLTGQRWRNVRTTLSPTFTGSKMRQMFAMILECSDNMVQALAHPTGRECEVKDL
FIRFTNDVIASCAFGVHVNSFRDKDNVFFRYGKDLSNFSRLKVALKIMGYQVFPKLMAQL
QMDIFDSTHVQFFTEMFRQSVQEREEHGIVRPDLIHLLIQARKGQLRYQPQESEETDGFA
TAKESNEQKILPEDMVKLSENEMIAQCLLFFLAGFDTIATSMTFVLYEVTLAPEIQQRLY
EEIQQVSETLDGKALTYDALQGMRYLDMVVSETLRKWSPSPGTDRMCNQDYTIPGDPDIV
IPKGATVFIPIAGLHYDPRFYPDPDRFDPERFNDENKHKIPLGAYLPFGIGPRNCIASRF
ALMEVKAIVYHILLNYELKRSERTSVPVKLAKGFSPLKPENGMYLKFNPRMKN
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggagataaacttaatgtacgttattggaatcgtatcggtgctggtggcactatacgtt
tacctaacgcacaacaacgatttcttcaagaaataccccataccctgcctgccagtggaa
ccacttttcggtagcagtcgccagtttttgctgaaaaaaatttcattcagcgaatttgtt
cgctcaaactacgaacgattcccgaatgcaaaaatgtacggtatgttcgagatgtttacg
ccgatgtttgtcattcgcgatccggagctgatcaagcagatcacggtgaaagatttcgat
cactttatcaaccatcgaccattaatgaaggcagacaactcttccaactctactgcaatg
ttctcgaaaatacttttcaatcttactggtcaacggtggcgtaacgtgaggaccacactt
agtcccacgtttaccggcagcaagatgcgccagatgttcgccatgatcttggagtgcagc
gacaacatggtacaggcccttgcacacccaaccgggcgtgaatgtgaagtgaaagatctg
ttcatccgcttcacaaacgatgtgatagcatcctgtgcgtttggtgtgcacgtcaactcg
ttccgagacaaagataatgtattctttcgctatggcaaagatttgtccaacttcagtcga
cttaaggtggcgctcaagatcatgggatatcaagtgtttcccaagctaatggcacaacta
cagatggacatattcgatagcacacacgtacagttcttcaccgaaatgtttaggcagtct
gttcaagagcgagaagagcatggtattgtgcgacccgatttgatccatctgctcatacaa
gctcgtaagggtcagctacgatatcaaccgcaagaatcggaggaaaccgatggttttgca
acagcaaaggagtccaatgagcagaagattcttccggaagatatggtgaagctcagcgag
aatgaaatgatagcacagtgtctgctgttcttccttgctggcttcgacacaatcgcaaca
tcgatgacatttgtactgtacgaagtgacgctagcaccggaaatccagcagcgtctgtac
gaggagatccaacaagttagcgagacattggatggcaaagcgctcacctacgatgctctg
cagggtatgcggtatctcgatatggttgtatcggaaacgctacgcaagtggtcaccatca
ccaggtaccgatcgaatgtgcaaccaagactatactattcccggtgatccagacatcgtt
attcccaagggtgctaccgtgtttatcccgattgctggtttgcattatgatcctcgtttt
tatccagatccagatcgtttcgatccagaacgtttcaatgatgagaataagcacaaaatt
ccgctcggagcatatctcccgtttgggataggacctcgcaattgcatagcgtcccgcttt
gctctgatggaggtgaaggccatcgtgtatcatatactgttaaactatgagcttaaacgc
tccgagcgtacctcagttccggttaagctggcaaaaggattttccccactgaaaccggaa
aatggcatgtacctgaagtttaatccaaggatgaagaattaa

DBGET integrated database retrieval system