KEGG   Anopheles gambiae (mosquito): AgaP_AGAP012373Help
Entry
AgaP_AGAP012373   CDS       T01036                                 

Definition
AGAP012373-PA
Orthology
K14298  
mRNA export factor
Organism
aga  Anopheles gambiae (mosquito)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AgaP_AGAP012373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3L
AA seq 362 aa AA seqDB search
TMFGTQALGANPGFGSPTATTTTNPMKDFEVTSPPEDTVSAMEFSPATLQQNFLIAGSWD
CSVRCWEVEQSGKTVPKSIKTMGGPVLDVCWADDGSKVFIASTDKQVKCWDLASDQVAQV
AQHDAAIKTCHWIKGTNYTCLMTGSWDKTLKFWDTRTPQPMMSIQLPERCYCADVDYPMA
VVGTAGRHVLIYSLENKPTQFKQQESPLKYQHRTVSVFRDKKKAPTGYALGSIEGRVAIQ
YVSPLNPKDNFTFKCHRSNGSSGYQDIYAVNDIAFHPVHGTLATVGSDGTFSFWDKDART
KLKSSETLDQSITKCCFNSNGQIFAYAVGYDWSKGHEYYNPQKKTYIFLRSCYDELKPRA
SS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
acaatgtttggcacgcaagcgctcggtgccaaccctggcttcggcagtccgacggccaca
accaccaccaatccgatgaaggacttcgaagtcacctcgccgccggaagatacggtgtcg
gcgatggagttcagcccggcaacgttgcagcaaaactttctcatcgccggcagctgggac
tgcagcgtgcgttgctgggaggtggaacagtccggcaagacggtgccgaaatccatcaaa
accatgggcggcccggtactggacgtgtgctgggcggacgatggcagcaaagtgttcatc
gcctcgaccgacaagcaggtgaagtgttgggatctggcctcggatcaggtggcgcaggtg
gcacagcacgatgcggcgatcaaaacgtgccactggatcaagggcaccaactacacgtgt
ctgatgacgggttcgtgggacaagacgctcaaattctgggacacccgaacaccgcagccc
atgatgtcgattcagctgccggagcgctgctactgtgcggatgtggactacccgatggca
gtcgtgggcacggcagggcgacatgtgttgatttactcgctggaaaacaaaccgacgcag
ttcaagcagcaggaaagtccgctgaagtaccagcaccggacggtgtcggtgtttcgcgac
aagaagaaagcaccgaccggttacgcgctgggcagtatcgagggccgtgtggccattcag
tacgtgagtccgctgaacccgaaggataacttcacgttcaagtgccatcgttcgaacgga
tcgagcggctaccaggacatctacgcggtgaatgacatcgcgttccatccggtgcacggc
acgctggcgacggtcgggtcggacggaacgttcagcttctgggacaaagacgcacgcacg
aagctgaaatcgtccgaaacgctggaccaatcgattaccaagtgttgcttcaacagcaat
ggacagatcttcgcgtatgccgtcgggtacgactggtccaagggacacgaatactacaac
ccgcagaagaaaacgtacatcttccttcgctcgtgctacgatgagctgaaaccacgggcc
tcgagctaa

DBGET integrated database retrieval system