KEGG   Anopheles gambiae (mosquito): AgaP_AGAP012373Help
Entry
AgaP_AGAP012373   CDS       T01036                                 

Definition
(RefSeq) AGAP012373-PA
  KO
K14298  mRNA export factor
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga03013  RNA transport
Module
aga_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AgaP_AGAP012373
Messenger RNA biogenesis [BR:aga03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     AgaP_AGAP012373
Chromosome and associated proteins [BR:aga03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    AgaP_AGAP012373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 PQQ_2
Motif
Other DBs
NCBI-GeneID: 1280339
NCBI-ProteinID: XP_320184
VectorBase: AGAP012373
UniProt: Q7Q0B6
Position
3L
AA seq 362 aa AA seqDB search
TMFGTQALGANPGFGSPTATTTTNPMKDFEVTSPPEDTVSAMEFSPATLQQNFLIAGSWD
CSVRCWEVEQSGKTVPKSIKTMGGPVLDVCWADDGSKVFIASTDKQVKCWDLASDQVAQV
AQHDAAIKTCHWIKGTNYTCLMTGSWDKTLKFWDTRTPQPMMSIQLPERCYCADVDYPMA
VVGTAGRHVLIYSLENKPTQFKQQESPLKYQHRTVSVFRDKKKAPTGYALGSIEGRVAIQ
YVSPLNPKDNFTFKCHRSNGSSGYQDIYAVNDIAFHPVHGTLATVGSDGTFSFWDKDART
KLKSSETLDQSITKCCFNSNGQIFAYAVGYDWSKGHEYYNPQKKTYIFLRSCYDELKPRA
SS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
acaatgtttggcacgcaagcgctcggtgccaaccctggcttcggcagtccgacggccaca
accaccaccaatccgatgaaggacttcgaagtcacctcgccgccggaagatacggtgtcg
gcgatggagttcagcccggcaacgttgcagcaaaactttctcatcgccggcagctgggac
tgcagcgtgcgttgctgggaggtggaacagtccggcaagacggtgccgaaatccatcaaa
accatgggcggcccggtactggacgtgtgctgggcggacgatggcagcaaagtgttcatc
gcctcgaccgacaagcaggtgaagtgttgggatctggcctcggatcaggtggcgcaggtg
gcacagcacgatgcggcgatcaaaacgtgccactggatcaagggcaccaactacacgtgt
ctgatgacgggttcgtgggacaagacgctcaaattctgggacacccgaacaccgcagccc
atgatgtcgattcagctgccggagcgctgctactgtgcggatgtggactacccgatggca
gtcgtgggcacggcagggcgacatgtgttgatttactcgctggaaaacaaaccgacgcag
ttcaagcagcaggaaagtccgctgaagtaccagcaccggacggtgtcggtgtttcgcgac
aagaagaaagcaccgaccggttacgcgctgggcagtatcgagggccgtgtggccattcag
tacgtgagtccgctgaacccgaaggataacttcacgttcaagtgccatcgttcgaacgga
tcgagcggctaccaggacatctacgcggtgaatgacatcgcgttccatccggtgcacggc
acgctggcgacggtcgggtcggacggaacgttcagcttctgggacaaagacgcacgcacg
aagctgaaatcgtccgaaacgctggaccaatcgattaccaagtgttgcttcaacagcaat
ggacagatcttcgcgtatgccgtcgggtacgactggtccaagggacacgaatactacaac
ccgcagaagaaaacgtacatcttccttcgctcgtgctacgatgagctgaaaccacgggcc
tcgagctaa

DBGET integrated database retrieval system