KEGG   Anopheles gambiae (mosquito): AgaP_AGAP012453Help
Entry
AgaP_AGAP012453   CDS       T01036                                 

Definition
AGAP012453-PA
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AgaP_AGAP012453
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    AgaP_AGAP012453
   00603 Glycosphingolipid biosynthesis - globo series
    AgaP_AGAP012453
   00604 Glycosphingolipid biosynthesis - ganglio series
    AgaP_AGAP012453
   00511 Other glycan degradation
    AgaP_AGAP012453
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    AgaP_AGAP012453
Enzymes [BR:aga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AgaP_AGAP012453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
AA seq 594 aa AA seqDB search
MFCAMSKYGIVVLVSFHAFQHAVSCLKDISYKCTNEEQCVRVYGNTKSASESHVFSTLSN
CRLLCGKYGPLWPRPTGHVTLGKETTVVNPLNLRFEQDFINQTTEGTTILREIKMYFLRN
LRKAFQTQILHESTPGMPIIIKIQITSNETNLSWYVDESYKLKISIENLTTVVTTIEAKT
IFGTRHGFETLLQLFTTVNSSVNILSQANIIDQPIYAHRGLLIDTARNYIPIKCLKRQID
AMAASKFNVFHWHITDTQSFPMQFDTVPEMVFYGAYSKEEVYSQNDIKSIIKYAKYRGIR
VILELDAPAHAGNGWQWGPEKGLGNLAVCVNQKPWRNFCIEPPCGQLNPINPNLYTVLQQ
IYKDIAEMNKEESVIHMGGDEVFFGCWNATAEIINYLMDHNLGRTEQDFLTMWSKFQVTN
GSAYSASTNEHSSPVILWSSRLTDPLVIDKFLSKSRYVIQTWLPSSSTIPKELQKLGYKL
IVSTKDAWYLDHGFWGVTTYYTWKKVYDNQLPKGNGILGGEVCVWTEYIDEYSIDGRTWP
RAAAAAERLWSNPETKAIDAESRFFCHRERLIIRGIQPEALAPRWCEQNEKQCH
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgttttgtgcaatgtcaaagtatggaatagtcgtattagtatcatttcatgcatttcaa
cacgctgttagttgcctaaaagacatatcttacaaatgcacaaatgaagaacaatgtgtt
agagtgtacggtaataccaaaagtgccagcgagtcacatgttttctctactttaagcaac
tgtcgtttgctgtgcggaaaatatggtcctttgtggcccagacctacaggccatgtgact
cttggaaaagaaacaactgtagtcaatcccttaaatctgcgatttgaacaagattttatc
aaccaaactactgaaggcacaacaatattaagagaaataaaaatgtattttttgcgcaat
ttgcgaaaagcatttcaaacccaaattttacatgaaagtacacctgggatgccaataatt
ataaaaattcagattacttcaaatgaaactaatctatcttggtatgtggatgaaagttat
aaattaaaaatatcgatagaaaacttaacaacagtagttacaacaatagaagcaaaaaca
atattcggtacacgtcatggtttcgaaacgctattgcaattgtttacgacagtcaattct
tctgtaaatatattgtcgcaggcaaacattattgaccaacccatctacgcccatcgtggg
ctcctaatcgacactgcgagaaattatataccaataaaatgtttaaaaagacaaatagat
gcaatggccgctagcaaattcaatgtttttcattggcatattaccgatacacaaagtttt
ccaatgcagttcgatacagttcctgaaatggttttttacggcgcctactcaaaagaagaa
gtttatagccaaaatgacattaaaagcataattaagtatgcgaaatatcgtggaatacga
gtcattcttgagcttgatgctcctgcccacgcgggtaatggctggcaatggggtcctgag
aaaggcctcggcaacttggccgtctgtgtaaatcagaaaccctggcgtaatttttgtata
gaaccaccatgtggccaactaaatccgataaatcccaacttatatactgtactgcaacaa
atctataaagatatagccgaaatgaataaggaagaaagtgttattcatatgggaggagat
gaagtattcttcggttgctggaatgcgacggcagaaatcataaattacttgatggatcat
aacctaggtcgaactgagcaagattttcttacaatgtggagtaagtttcaggtaacaaat
ggctcagcctattctgcatctacaaacgagcattcaagtccagttattttgtggtccagt
cgcttaacagatccgttggtaattgacaaatttttgtctaaaagccgatatgtgatacag
acatggcttccgtcaagcagtactatacctaaagaattacaaaagttaggctacaagctt
attgtttcgaccaaggatgcttggtatcttgatcatgggttttggggagtaacaacctat
tacacctggaagaaagtatacgataaccagttacctaaaggaaatggtattttaggagga
gaagtttgtgtatggactgagtatattgatgaatattcaattgacggacgcacttggcca
agagcggcagcagctgcagagcgactatggtcaaatccggaaacaaaagctatagatgcc
gaatcacgttttttttgccaccgcgaacggcttatcatccgtggaatacaaccggaagct
ctagctccgcgatggtgtgaacaaaatgaaaaacaatgtcattaa

DBGET integrated database retrieval system