KEGG   Anopheles gambiae (mosquito): AgaP_AGAP012481Help
Entry
AgaP_AGAP012481   CDS       T01036                                 

Definition
AGAP012481-PA
Orthology
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:aga00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
AA seq 579 aa AA seqDB search
IITGRRTRNAEKKNANLVHDDTASPKRKDIKYTHEDSNNPVANIEQRNNTSVCDEPMKLR
GGRVKMADISKYLEKKNDSNITEKSITLVQSKSNLDITDENVCEIVEAQLLEASISFSDA
TLTRNNFVDPKKSKNNNIFLQEPVLHLNFAKISNPSSRTLSMVQNSILTQQDVKTGLFTT
PSQPKINSFWKEVTLTRNIKGTNDEKERSSMSNNEQHILDLSKPTQVTQIDSTTTAENVS
TDDDNSCDSGDSGVILSGTNGTITMSLTNNQTNLSACAEQIGEAENRKKPATPHRILCPS
PTKNAIIYLQSPPGLLNNSSSGKSRNKRQAGNNKTRKRYLEICFKLDAENGVAATEEIKE
MKPEQLHDVANAARDSAVPIELNKNIVHQNRKIVVGSANFKPGCNKKITEYYPIRRSVRK
TKKEVQVERDRDIERAIKEGREDGLKIEYFEGKGRGIVTTRSFAKGEFVVEYIGDLISVA
EAKQREQVYSKDDSTGCYMYYFRHKNVQHCIDATAESGKLGRLVNHSRNGNLVTKTVPIN
NRPHLVLIAKEDIEKGVEVTYDYGDRSKEALLHYPWLAL
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
attattacaggtcgacggacgcgcaatgctgaaaaaaaaaatgctaatcttgttcatgat
gacacagccagtccaaagcgaaaggatattaaatacacacatgaagatagtaacaatcct
gtcgcaaatattgaacagcgaaataatacctcggtttgtgacgagcctatgaagcttcgt
ggcggccgcgtgaagatggcggacatatctaaatatttggaaaaaaaaaatgattctaac
attaccgaaaaatctataacactggtacaatcaaagagcaacttagatataacagatgaa
aacgtttgtgaaattgttgaggctcaacttttggaagcaagcattagtttttcagatgct
acactaacaagaaacaattttgtagatccaaaaaaatcgaaaaataacaatatttttctt
caggagccagtcctacacttaaacttcgccaaaatatcaaacccttcatctcgaacttta
agtatggtgcaaaattctattttaacacaacaagatgtaaaaactggtctcttcacaaca
ccatcgcaaccaaagataaattcattctggaaagaagttactctgaccaggaacatcaaa
ggcacaaatgatgagaaagaacgatcatcaatgagcaataatgaacaacatatattagat
ctgtctaaaccaacacaagtaacccaaattgattctactactactgcggaaaatgtatcg
accgatgacgataattcgtgcgatagcggtgatagcggcgttattctgtcaggaactaac
ggaaccattactatgtccctcacaaataatcaaacaaatttgtcagcatgtgctgagcag
ataggtgaggctgagaatcgaaagaaaccggccaccccgcatcgtattctttgtccttca
cctacaaaaaatgctatcatataccttcaaagcccgcctggacttctcaataattcttcg
tcaggaaaaagccgtaacaaacgacaggctggcaacaataaaactcgtaaaaggtatttg
gaaatatgttttaaacttgatgcagaaaatggtgttgcagctacagaagaaattaaagaa
atgaaacctgaacaattacatgatgttgcgaatgctgctcgtgattcagctgttccgatc
gagctgaataaaaatattgtacatcaaaaccggaaaatagttgttggatcagcaaatttt
aaacctggatgtaacaaaaaaattacagaatattatccaatcaggcgaagtgtacgcaaa
acaaagaaagaagtacaagttgaacgagatcgtgatattgaacgagccattaaggaaggg
cgtgaagatggactcaagatcgaatattttgaaggaaagggtcgaggcatcgttacaacg
aggagctttgcgaaaggagaatttgtagtagaatatattggcgaccttataagtgttgcc
gaagcaaaacaacgagaacaagtttattctaaggatgatagtacaggatgctacatgtac
tacttcaggcacaagaacgtacagcactgtattgatgcgacagcagaaagtggaaagctc
ggacggttagtaaaccattcccggaatggaaatttggttaccaaaaccgtgcccatcaat
aatcggccgcaccttgttttaattgccaaagaagatattgaaaagggtgtagaagtgaca
tacgattatggtgaccgttcaaaagaagcattacttcattatccatggttagcattataa

DBGET integrated database retrieval system