KEGG   Anopheles gambiae (mosquito): AgaP_AGAP012555Help
Entry
AgaP_AGAP012555   CDS       T01036                                 

Definition
AGAP012555-PA
Orthology
K11252  
histone H2B
Organism
aga  Anopheles gambiae (mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
AA seq 94 aa AA seqDB search
TDRQSYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITS
RSRRRCDCCSPASWPSTPCPRAPRPSPSTPVPSK
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
acagacagacagagctacgccatctacatctataaggtgctgaagcaggtgcacccggac
accggcatttcctccaaggcgatgagcatcatgaacagcttcgtgaacgacatcttcgag
cggatcgcggcggaagcgtcccgcctggcgcactacaacaagcgctccaccatcacgtcc
cgctccagacggcggtgcgactgttgctccccggcgagctggccaagcacgccgtgtccg
agggcaccaaggccgtcaccaagtacaccagttccaagtaag

DBGET integrated database retrieval system