KEGG   Anopheles gambiae (mosquito): AgaP_AGAP012710Help
Entry
AgaP_AGAP012710   CDS       T01036                                 

Definition
AGAP012710-PA
Orthology
K11252  
histone H2B
Organism
aga  Anopheles gambiae (mosquito)
Brite
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AgaP_AGAP012710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
AA seq 124 aa AA seqDB search
MAPKTSGKAAKKSGKAQKNISKSDKKKKRKTRKESYAIYIYKVLKQVHPDTGISSKAMSI
MNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaaaaccagtggaaaagctgcgaagaagtctggcaaggcccagaaaaatatt
tccaagtccgacaagaaaaagaagcgcaagacccgcaaggaaagctacgctatttacatc
tacaaagtgttgaagcaagtccacccggatactggcatctcttcgaaggccatgagcatc
atgaacagtttcgtcaacgatatcttcgaacgcattgctgctgaggcatcccgcttggcg
cactacaacaagcgttcgacgatcacgtcccgcgaaatccaaaccgctgttcgtctgctg
ctgcctggtgagcttgccaagcacgccgtctccgaaggaacgaaggctgtcacaaagtac
accagctcgaagtaa

DBGET integrated database retrieval system