KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AAL050WHelp
Entry
AGOS_AAL050W      CDS       T00167                                 

Definition
AAL050Wp
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    AGOS_AAL050W
Enzymes [BR:ago01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     AGOS_AAL050W
Glycosyltransferases [BR:ago01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   AGOS_AAL050W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:256489..258450
Genome map
AA seq 653 aa AA seqDB search
MAESGEAMGAVPEAAESEAQVVSKNGPFRSYLPSTVYQAWRGERMEQQGVVVWCGPAAFA
ALYVLCSGWLAACAGLAASGTETEMLEEIDAVRLGGFHIGVRPPLGLHVLARLGLGLIGL
RRLALLAACVVLQYLYKSLRCAGIQRLWAGAAVGCIALLEVFRDAAVHASLEMYHAMFLA
IILYNWKSFKLQEPFGQAWWLRLSAVAVCSGLAAGTKFVGLGTWAWVLLLNSAHIFQLIG
DLEVSTRTVWKHVLIRLPLLTLVPLSIILLGYHSHLQAPSYSSRDSSYMPTLFKAQLDGY
QVVQPASVYYGSGVVIRHSSSIGGYLHSHELTYPGGSEEQQITLYDFEDANNKWTVEPVY
NEAMDDIINSTQPVRNGDLIKLRHVQTGKLLRASAAKPPVSQRDYDQEVSCTGDSGYSGD
SDETWRVDIQDAEYHEDLKPVLHHFSLVNKGQSCTLLSHDVKLPEWALYQQEVICLASPV
HKYSLFYVDSSEMMHNETMQLPRLSFPAKFWAYIHAQYKYDYFVKNFNATGDVPYLRWLV
HISENKLQNCIWVAGLLSVIWWWLLFTYRCFTWNPWDPAVAFEPTTLRSALYRDNSFEYV
AGWFIHYIVFSRCSHGNLQIVQYLPALLFTTLQIANTFQTFSEWIHRLIVKLF
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggcagagagcggtgaggcgatgggagcggtgccagaggcagcggagagcgaggcccag
gtggtgagcaaaaacggcccgttccggtcgtacctgccgagcacggtgtaccaggcgtgg
aggggcgagcggatggagcagcagggcgtggtggtgtggtgcgggcccgcagcgttcgcg
gcgctgtacgtgctttgtagcggttggctggcggcctgcgcggggctggcggccagcggg
accgaaacagagatgttggaagaaatagatgcggtgcgactaggcggcttccacatcggg
gtgcgaccgccgctcgggctgcacgtgcttgcgaggctcggactggggctcatcggcctg
cggcggctggcgctgctagcggcatgcgtggtgttgcagtacctgtacaagagcctacgg
tgtgcggggatacagcgcttatgggcgggggcggcggtgggctgcattgcgttgctggag
gtgttccgggatgctgcagtgcacgcatcgctggagatgtaccatgcgatgttcctggcg
atcatactgtacaactggaagagcttcaagctgcaggagccgttcggacaagcgtggtgg
ctacggctctctgcagtggcggtctgcagcggcctggctgcgggcacaaagtttgtcggc
ctgggtacctgggcgtgggttctcctcttgaattccgcccatatattccaactgatcggc
gatctggaggtatcgacgcggactgtgtggaaacatgtcctgataaggctgccgctgcta
actttggtgccgctatccataattcttttaggctaccatagccacttacaggcacctagt
tacagctcgcgtgattcttcctacatgcctacgttgttcaaggcgcaattggacggatat
caggtggtgcagccggccagtgtgtactatggaagtggggtggttattcgccacagtagc
tccatcggcgggtacctccattcgcatgagctaacctatccgggcgggtcagaagagcaa
cagatcaccttatatgattttgaggacgcgaacaacaagtggacggtggaaccagtgtat
aatgaggcaatggatgacatcataaacagtacccaacccgtccgcaatggcgatttgatc
aagctaaggcatgttcagacgggcaagttgctgcgagcgtccgccgcgaagccgcctgta
agtcagcgagattacgatcaggaggtttcctgcactggcgacagcgggtatagtggggac
agtgatgagacatggcgggtcgatattcaggatgcagaataccacgaggacctaaagcct
gttttgcatcacttcagcctagttaacaaggggcagtcttgcacccttctgagccacgac
gtcaagctgccggagtgggccctgtaccagcaggaagtgatttgccttgcgtctccagtg
cacaagtattcgttattctacgtggattcctccgagatgatgcacaacgagacgatgcaa
ttgccgagattgtcttttccggcaaagttctgggcgtacatccacgcgcaatacaagtat
gactactttgttaaaaactttaacgcaacgggcgatgtcccttacctaagatggttagtc
cacatttcggaaaataaactccaaaactgtatctgggtagcaggacttctaagcgttatt
tggtggtggttgctatttacttaccgctgctttacctggaatccctgggaccccgctgtg
gcatttgagccaaccactcttcggtcagccctatacagggacaactcgttcgagtatgtt
gccggatggttcatacattacattgtcttctcccgctgttcgcatggtaacctgcagata
gtccagtatctgccagctttgctcttcacgaccttgcagattgcgaacacattccaaacg
ttttcggaatggatacaccgattaattgtaaagcttttctag

DBGET integrated database retrieval system