KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AAL121CHelp
Entry
AGOS_AAL121C      CDS       T00167                                 

Definition
(RefSeq) AAL121Cp
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
Enzymes [BR:ago01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     AGOS_AAL121C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 Spore_IV_A Flavodoxin_5
Motif
Other DBs
NCBI-GeneID: 4618441
NCBI-ProteinID: NP_982421
UniProt: Q75F49
Position
I:complement(133709..135775)
Genome map
AA seq 688 aa AA seqDB search
MALKFDKLDFAVICALALAVVAYLKLDVLKELFAADDSALAVQSSSRDIVEVLRENKKDY
LVVYASQTGTGEDYAKKFAKELAAKYSLNVMCVDVENYDFDNLNSLPKDVIVSFFVSTYG
EGDLPDGGLEFEEWLQVLEEGDLGNVRYTMFGLGNSTYEFYNGAAEKTQKLLKQAGARML
GTFGKADDGAGTTDEDYMAWKDDILEELKDALALHEKEVSFISSYEYKVLPQDLMGSISL
GEPNSQYLPGKTLAKKENMQLGPFDATHPYVAPITSTKELFKKKDRNCIHVEFDLSGSNL
KYSTGDHLGVWPSNPDEKVEKFLTTFGLDPTTIFDLKPKDITIKPPFPVPTTIGAAVRYY
LEISGPVSRQVIGSLLQYVTEEQLKERLQALSKNKEKYAKEITSKCMDLADALLYLSSGK
KWTQVPWEFLIETVPHMQPRYYSISSSSSSDKQTVHITAVVENYPNPEVSSLGPVTGVTT
NLLRHIHLTRTKEDIAASSLPVHYNLAGPRDLYQNYKLPVHVRRSTFRLPSNPSTPVIMV
GPGTGVAPFRGFIRERISFLKNQENVKLGKHLLFYGCRDDADFLYHDEWPVYAKELGSSF
ELMVAYSRIPNKKKVYVQDHLLERENEVLELINKGAFIYVCGDAKGMSQDVHRTLIDILR
RGKNISEEESSEILKQFKTTGKYQEDVW
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggcactgaagtttgacaaattagattttgctgtcatatgtgcgttagcgctagcagta
gtcgcttatctgaagctggatgtgctcaaagagctatttgcagcggatgattcggcgtta
gccgtgcagtccagctcgcgggacatcgttgaggttctgagggagaataaaaaggattac
ctggttgtctatgcgtcccagactggtactggagaggattacgccaagaaatttgcaaaa
gagttggcagccaaatactctctaaacgttatgtgtgtcgacgttgagaactacgacttc
gataacttgaactcattgcccaaggatgtgattgtgtcgttcttcgtgtctacttacggc
gagggcgacctgccagatggcgggctagaattcgaggaatggctgcaggttttggaagag
ggagatctcggcaatgtccgttatacgatgttcggtcttggcaactccacctacgaattc
tacaacggcgctgccgaaaagactcagaagctattgaagcaggcgggagcacgtatgctg
ggtacttttgggaaggctgacgacggcgctggaacgactgacgaggattacatggcctgg
aaggacgatatcttggaggagctgaaagacgcattggcgctacatgagaaagaggtctca
tttatatccagttatgagtacaaggtactaccccaggatttgatgggttctatttccctg
ggtgaacctaacagccaatatcttccaggcaaaacgcttgcgaagaaagaaaacatgcag
ttgggaccttttgatgcaacgcacccttatgtagctcccattaccagcacaaaggagtta
ttcaaaaagaaggaccgcaactgtattcatgtggagtttgatctttcaggctccaacctc
aagtactctacaggtgatcatcttggtgtgtggccatccaatccggatgaaaaagtagag
aagttcctaacgacgtttggtcttgatccgacgaccatttttgacttgaagcccaaggat
attaccatcaaaccgccattccctgttccaacaacaattggtgcggcagtcagatactac
ttggagatatctggcccagtatccagacaggtcattggctctttactccaatatgttaca
gaggagcaattaaaggagagattacaagcgctatctaaaaacaaggaaaagtatgctaaa
gagatcacatccaagtgtatggatttggcagatgctttgctatacctctccagcggcaaa
aagtggacccaggtcccatgggagtttttaatcgaaaccgtgccgcacatgcagccccgt
tactattcgatttcttcgtcatcatcctccgacaagcagactgtgcacatcactgccgta
gttgaaaactatccaaaccctgaggtatcatcattaggtcctgtaaccggtgttaccacc
aatctgctcagacacatccacttgacccgtaccaaggaggacatcgccgcctcgtctttg
ccggtgcattacaatctagctggcccccgtgacttataccagaattataaactccctgta
catgtacgccggtcgactttccggttgccatcaaacccaagtactccagttattatggtc
ggtccaggtactggtgtagccccattccgcggctttattcgcgagcgtatcagcttcctg
aaaaaccaggaaaacgttaagctgggaaagcatctccttttctatggatgccgggatgac
gccgattttctataccatgatgaatggcccgtctatgccaaagaacttggcagttctttt
gagttaatggtcgcttattctagaattccgaataagaagaaggtatacgttcaggatcat
ctcttggagcgcgaaaatgaagtactagaactaattaacaagggcgcattcatatatgtc
tgtggtgatgctaagggcatgtcacaggatgttcaccggacactaatcgatatattgaga
agagggaaaaatatctctgaggaagagtcctctgagattctcaagcaattcaagactacc
ggtaagtaccaggaagatgtgtggtaa

DBGET integrated database retrieval system