KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AAR008WHelp
Entry
AGOS_AAR008W      CDS       T00167                                 

Definition
AAR008Wp
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AGOS_AAR008W
Enzymes [BR:ago01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     AGOS_AAR008W
Glycosyltransferases [BR:ago01003]
 Polysaccharide
  Storage polysaccharide
   AGOS_AAR008W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:356281..358392
Genome map
AA seq 703 aa AA seqDB search
MTRDIQNHLLFETATEVANKVGGIYSVLKSKAPVTCAQYKDHYHCIGPLNPDSVQIEVEA
LDWEDDSVWSREMLPVKRSLQHMRERGVNFVYGRWLVEGAPRVILFDLVSVTHHLNEWKA
DLWNSCGIPSPQDDQETNNSILLGYTVAWFLGELTAQDQQHAIVAHFHEWLAGVALPLCR
KRRIDVVTIFTTHATLLGRHLCAGNADFYNNLDKFDVDAEAGKRGIYHCYCIERAAAHTA
DVFTTVSQITAYESEHLLKRKADGILPNGLNVIKFQTVHEFQNLHALKKERIHDFVRGHF
HWNYDFDLDKTLYFFIAGRYEYRNKGADMFIEALARLNYRLKAAGSKMTVIAFIIMPAKT
RSYTVEALKGQAVVKALESTVKDVTTSIGHRLFEHAMRYPRSGKSEIPTDLGELLKPSDT
VLLKKRVFALRRPESSLPPIVTHNMVDDASDPILNQIRRVQLFNNSSDRVKIIFHPEFLN
ANNPILSLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGAYMEDLIE
RDQAKDYGIYIVDRRFKNPDESVEQLVDYLDDFCKKTRRQRINQRNRTERLSDLLDWRRM
GLEYVKARQLALRRAYPEEFRALVGEDLDDHDMDSLAGGQKFKVARPLSVPGSPRDRSSS
MSAILMTPGDLGTLQDANNANDYFHLSMQTDDDEEGEDGREDD
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagatatacagaaccacctactcttcgagacggccacggaggtagcgaacaag
gtcgggggcatctactcggtgctgaagtcgaaggcaccggtgacctgcgctcagtacaag
gaccactaccactgtattgggcccctgaatccagactcggtgcagatagaagtggaggcg
ctggactgggaggatgacagcgtgtggagccgggagatgctgccggtaaaacggtcgctg
cagcacatgcgggagcgcggcgtgaacttcgtatatggccggtggttggtggagggtgcg
ccgcgggtgatcttgttcgaccttgtttccgtgacgcaccatctcaacgagtggaaggcc
gacctgtggaacagctgcgggatcccctcgccgcaagatgaccaggagacgaacaactcg
atcctgttagggtacaccgtggcttggtttctcggagagttgacggcgcaggaccagcag
catgcgattgtggcccacttccacgaatggcttgcaggcgtggcgctgcccctatgtcgg
aaacggaggatcgacgtggtgacgatattcaccacccatgcgactttgttgggaagacat
ctgtgtgcaggcaatgctgatttctacaacaatttggataagtttgatgtcgatgcagag
gccggtaagcggggcatttaccattgctactgtatcgagcgggcggctgcccatacggcc
gatgtcttcacgactgtttcgcagattactgcatacgagtccgagcacttgctgaaacgg
aaggctgacgggatcttgccgaatggtttgaatgtcataaaatttcaaacagtgcacgaa
ttccaaaacctgcacgccctcaagaaggaacgcatccatgactttgtacgcggtcacttt
cactggaactatgactttgacctagacaagacgctgtacttcttcatcgctggtaggtat
gaatatcgcaacaaaggtgccgatatgtttattgaggcgttggcacggctaaactaccgg
ttaaaggctgcgggatcgaagatgacggtgatagcgtttatcatcatgccagcgaagact
aggtcgtacactgtggaggctctgaagggccaggcggtggtcaaagctctcgagagcacc
gttaaggatgtaacgacttccatcggccacaggttgtttgagcatgccatgagataccct
cgcagcggcaaatccgagataccaaccgatctgggagaactattgaaaccctctgacact
gtgcttctaaaaaaacgtgtatttgcattgcgcaggccagaaagttcattgccaccgatc
gtgacgcacaatatggttgacgacgcctctgatcctattctaaatcaaataaggcgggtc
caactattcaacaactcctccgaccgagtaaagattatctttcacccagagttcctcaat
gcgaacaaccctattctgtcgctggactatgacgagtttgtcagggggtgccatctgggc
gtgttcccctcgtactatgaaccatggggctacactccagcggagtgtaccgtcatgggt
gtcccatctattacgactaatctgtctggttttggtgcatacatggaggatctgatcgag
agagaccaggcaaaggactatggtatttatatcgtggaccggagatttaaaaacccagac
gaaagtgtcgagcagttggtggactacctagacgacttttgcaagaagactaggcgacag
agaatcaatcagagaaatagaaccgaaagactgtctgacctcttggactggcgccgcatg
ggcctggagtatgttaaagcacgccagctggccttacggcgtgcgtaccctgaggagttc
agagccttggtaggcgaggacctggatgaccatgatatggattctcttgctgggggccag
aagttcaaggttgcaaggcctctttctgtccctggctcacccagagaccggtcgagctcg
atgagcgccatcctgatgacccctggagatctgggaacgctgcaggatgctaacaatgcg
aatgactacttccatctgtcaatgcagaccgacgatgacgaggagggagaggatggccgc
gaagatgactaa

DBGET integrated database retrieval system