KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AAR021WHelp
Entry
AGOS_AAR021W      CDS       T00167                                 

Definition
AAR021Wp
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ago00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:379870..381441
Genome map
AA seq 523 aa AA seqDB search
MPVPASVLQAGSKVLVVGGGIGGLSYAYFLSRLRPDIKVKLLETRQNCRGSIVSKPTSLP
DGSVVNLEKGPRTLRGVSDSAVIIMDLVRQLGESQSIYGIAKDSPANRKFLLDHKGELLQ
LPNSWKTFRKFMQNPLSDGLVRGILGEPFRRTRPESSADESAFDLFVRRFGNAQVPNNLL
SSLFHGIYGDDIQLLSAQRIARRFYEMEQEHSSFIRAGISGIFKKPALSLSLDKYQETFG
RDKEELLQLKKTLSQFPILGFKGGMEFLPRLILKELSGMPNVEICTGKLVSAVSPAKDGK
IEVVAKDGTRYTGIDHVRLAVSPMSIKRMLSEQSISSHLERASANTIAVVNFYLPKKDVI
ADYHSFGYLAPISIPNPHKLLGVIFDSVVERSYTPLFAPSTDRFAQGQYTKMTAMMGGHY
FSQQDLQNPPSEDGIIQNIKNVFKRHLHISEADLAAAHWSVTLAKNCIPHFHVGYNQWET
VLRGKIQSEYGHRISLGGMAFSSGPGVPDVFMNGFLDAVSMAK
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgccagtcccagcatccgtgcttcaggcaggtagcaaggttctggtagttgggggaggt
ataggtggtctctcatatgcatattttctttctagattgagaccagatataaaggtgaag
ctgctggagaccaggcagaattgtcgcgggagcattgtttccaaaccaacctcccttcct
gatggcagtgtggtaaacttggagaaaggccctcgaaccctgcgcggggtttcggacagc
gccgtgatcattatggatctagtgcgccagctaggcgaatcccaatcaatttacgggata
gcgaaggatagtcctgcgaaccggaagtttctgctggatcataagggcgaactgctgcag
ttgccgaactcttggaagacatttcgcaaattcatgcagaacccgctgagcgatggcctc
gtaagaggaatattaggggagccatttagacgtactcgaccggaatcaagtgccgatgaa
tctgcgtttgatctttttgtgcggcgatttgggaacgcacaagtgcccaacaaccttttg
agctcgcttttccacggcatatacggcgatgacattcagctacttagcgcgcagcggatc
gcgcgccggttttacgagatggaacaggagcactcatcattcatcagggctggcatatcc
gggatctttaagaagcccgcactgtctctatcacttgacaaataccaagagacatttggt
agagacaaggaagagttgctccagctgaagaagactctaagccagttcccgattttgggt
ttcaaaggcggaatggaattcctgccccggctaatcctaaaagaacttagcggaatgcca
aacgtggagatctgtaccgggaaactcgtgagcgccgtctccccagcgaaagacggcaag
atagaggttgtagcgaaggacggcacgcgttacacgggcattgaccacgttcgcctagca
gtcagcccaatgtctatcaaacggatgctctccgagcagtccatctcgagccacctagag
cgtgcttctgccaacaccatagcagtcgttaacttctaccttcccaaaaaagatgtcatc
gctgattaccacagcttcggatacctggcgccgatctccattccaaacccccacaagctg
ctcggcgtgatttttgattcggtggtggagcggagctacacgccgctgtttgcaccatcc
accgaccgcttcgcgcagggccaatatacaaagatgacagcgatgatggggggccactat
ttttcacagcaagacttgcagaaccccccttccgaagatggaatcatacagaatatcaag
aatgttttcaagcgccatttgcacatatccgaagctgatctggctgctgcccactggagt
gtcacactggcaaagaactgtattccccatttccacgtgggatacaaccagtgggaaacc
gtcctacgcggaaaaatacaaagcgaatatgggcaccgtatatccctcggtggtatggct
ttcagctctggccctggcgttcctgacgttttcatgaatggcttcctcgatgctgtatcc
atggcaaagtga

DBGET integrated database retrieval system