KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AAR059CHelp
Entry
AGOS_AAR059C      CDS       T00167                                 

Definition
(RefSeq) AAR059Cp
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00260  Glycine, serine and threonine metabolism
ago00750  Vitamin B6 metabolism
ago01100  Metabolic pathways
ago01110  Biosynthesis of secondary metabolites
ago01230  Biosynthesis of amino acids
Module
ago_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AGOS_AAR059C
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AGOS_AAR059C
Enzymes [BR:ago01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AGOS_AAR059C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 4618427
NCBI-ProteinID: NP_982600
UniProt: Q00063
Position
I:complement(447537..449075)
Genome map
AA seq 512 aa AA seqDB search
MSQVYRSTRSSSEDTKSFEEAVIQGLAEDGGLFLPAVIPRLREETLFEHWAHLSFQDLAM
EIMKFYIADWEIPAPELRELIERSYSSFRSEEVTPLRKNVTGDDENLHILELFHGPTYAF
KDVALQFVGNLFEYFLERKNRDVSEEERTHLTVVGATSGDTGSAAIYGLRGKQDVSVFIL
YPHGRISPIQEEQMTTVEDENVHTMAIEGSFDNCQDIVKSIFVDEEFNRKHNIAAVNSIN
WARILAQITYYFYSYFRATDGQPGRVKFIVPSGNFGDILAGFYAKQMGLPIEKLVIATNE
NDILDRFLREGVYERSEDVTATHSPAMDILVSSNFERLLWFFAREQLAQGDDQEAGSIVN
RWFEQLREERRFDVPEHLLDAIRYHFDSERVDNYNTLASIRHIYEHAQNPERYVIDPHTA
VGICAANRQIAHDQNNEIHYISLATAHPAKFADAVNEALSSYDDYNFDDVLPDRLRRLGD
LEKRIKYVDNTDVDVIKSIIEEELINMGIYNP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagtttaccgctcgactcgctcgtcgtcggaggacactaaatcgttcgaagag
gctgtgatccaaggcctcgccgaggacggcgggctgttcttgcctgctgtgatccccaga
ctcagggaggagacgctgttcgagcactgggcgcacctgtcgttccaggacttggcgatg
gagatcatgaagttctacattgcggactgggagatccctgcgccagagctgcgggagctg
atcgagcggtcgtacagctcgttccggtcggaggaggtgacgccgctgcgcaagaacgtg
acgggcgacgacgagaacctgcacattctggagctgttccacgggcccacctacgcgttc
aaggacgtggcgctgcagttcgtgggtaacctgttcgagtacttcctggagcgtaagaac
cgggacgtgtctgaggaagagcgcacgcacctgactgttgtgggcgccacgtccggggac
accgggtctgcggcgatctacgggcttcgcggcaagcaggacgtgtctgtcttcatcctg
taccctcatgggcgcatctctccgatccaggaagagcagatgaccactgtggaggacgag
aacgtgcacactatggcgatcgagggctccttcgacaactgccaggacatcgtgaagtct
atcttcgtggacgaggagttcaaccggaagcacaacatcgctgccgtcaactccatcaac
tgggcgcgcatcctagcccagatcacctactacttctactcttacttcagagcgaccgac
ggccagccggggcgtgtgaagttcatcgtgccatctggtaacttcggcgacatcctagcc
ggcttctacgccaagcagatggggcttccaattgagaagctggtcattgccaccaacgaa
aacgacatcctcgacagattcttgagagagggtgtgtacgagagatccgaggacgtcaca
gccacgcactctccagccatggatatcttggtctcttccaacttcgagagactgctatgg
ttctttgcccgcgagcagcttgctcagggtgacgaccaagaggctggttcaattgtcaac
agatggtttgagcagttgagagaggagcgccgctttgacgtgccagagcacctcctagac
gctatcagataccacttcgactctgagcgtgttgacaactacaacactctcgccagtatc
agacacatctacgagcacgctcagaaccctgagagatacgtcattgacccacacacggct
gtcggtatctgtgcggcgaacagacagatcgctcatgaccaaaacaacgaaatccactac
atttcgcttgccactgctcacccagcgaagtttgcggacgctgtgaacgaagctctctcc
tcttacgatgactacaacttcgatgacgttcttccagaccgtctaagacgtctaggtgac
cttgagaagagaattaagtacgtggacaacaccgacgttgatgttatcaaatctatcatt
gaggaggaactgattaacatgggcatttacaatccatag

DBGET integrated database retrieval system