KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AAR071WHelp
Entry
AGOS_AAR071W      CDS       T00167                                 

Definition
AAR071Wp
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AGOS_AAR071W
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AGOS_AAR071W
   00640 Propanoate metabolism
    AGOS_AAR071W
  Lipid metabolism
   00061 Fatty acid biosynthesis
    AGOS_AAR071W
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    AGOS_AAR071W
Enzymes [BR:ago01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     AGOS_AAR071W
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     AGOS_AAR071W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:466766..473461
Genome map
AA seq 2231 aa AA seqDB search
MSEGSFTEAMESQKRYEFTDYSAKHARLAPHFIGLNTVEQAEASPLRDYVRLHGGHTVIS
KILIANNGIAAVKEIRSVRKWAYETFGDGKVVQFVVMATPEDLEANTEYIRMADQYVEVP
GGTNNNNYANVDLIVDVAERADVDAVWAGWGHASENPLLPEKLARSKRKVVFIGPPGSAM
RSLGDKISSTIVAQHAKVPCIPWSGTGVDQVEIDPHTKLVSVADDIYQKGCCLSPEDGLN
KAKQIGFPVMVKASEGGGGKGIRKVVREEDFISLYQQAANEIPGSPIFIMKLAGKARHLE
VQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFAEMERAAVRLGKLVGYVS
AGTVEYLYSHEEDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPLHRIRDIRL
FYGLDPHTATEIDFEFSSADALQTQRRPIPKGHCTACRITSEDPNEGFKPSGGSLHELNF
RSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTTV
EYLIKLLETEDFEDNTITTGWLDDLISQKISAEKPDPMLAVICGATTKAHIASEQALQEY
ASYLKRGQVPNKNMLKTMYPVEFIHEEKRYKFTVAKSADDRYNLFINGSRCEVGLRKLSD
GGLLIAAGGKSHTVYWKEEVAATRLSIDHQTTLLETENDPTQLRTPSPGKLVNFLVESGD
HLEAGQPYAEIEVMKMQMPLIAQESGVLQLLRQPGSTLAAGDILAILTLDDPSKVKYAMP
FEGMLPDLGAPVIEGTKPAYKFRSLVSTLENVLKGYDNQVIMNASLQKLIEVLRDPQLPY
SEWKMQVSALHSRLPQALDQQLEQLVERCHKRSADFPAKQLGKILENAINERKSDPLFQT
VVEPLTSITTRYKTGLQDHEHAVLGSFLENYYSVEKLFSGSKVNEEDVILKLRDENADDL
NKVVMTVLSHSRVSAKNNLISAILKHYRPLCKLSSEVAAKISVPLKHIVQLESKATAKVA
LQAREILIQAALPSVRERTEQLEHILKSSVVKPTYGATEMNHTDPNIEVLKDLIDSNYVV
FDVLTQFLNHRDKYVIAAAAEVYIRRAYRVYTVGDIKYHSGFDTPIFEWKFQLPSAAFTS
RPQVTSRLGVNRAISISDLTYVSEAENQPSRTGLLVPAPHLDDVDSILSNALSVIPMQLS
HSGPLPDRSAAANPSLSNVVNVVISSTEGFDSEAEVLDRLKEILELNKSELLASAIRRIT
FVFGYRDGSYPKYYTFRGSDYVEDKTIRHIEPALAYQLELGRMSNFHIKPIFTENRNIHV
YEAIGKNSPVDKRFFTRGIIRTGRIRDDITIQEYLTSEANRLMSDILDNLEVTDTSNSDL
NHIFINFSAVFDVSPADVEAAFGGFLERFGKRLLRLRVAAAEIRIMIKDPGSGTPVALRA
LINNVSGYVVRTELYTEVKNANGDRIFKSLDKPGSMHLRPIATPYPVKEWLQPKRYKAHL
MGTTYVYDFPELFRQATLSQWRKHSPKMQLSDDFFIANELISDENGELTEVDREPGTNSI
GMVAFKVTVKTPEYPHGRQFVIIANDITYMIGSFGPQEDEFFEKVTNYARKRGIPRIYLS
ANSGARIGIAEELVPMFSVAWKTPGNPEKGFDYLYFTTEMYETLKQSGKENVVITERIVE
DGEERYAIKAIIGSEDGLGVECLRGSGLIAGATSKAYKDIFTITLVTCRSVGIGAYLVRL
GQRAIQVEGQPIILTGAPAINKVLGKEVYSSNLQLGGTQIMYNNGVSHLTAQDDLAGVEQ
IMEWLSYIPAKRNMPVPILQSEDNWDRDVEYTPTLSQPYDVRWMIEGRQGPDGFEYGLFD
KGSFQETLSGWARGVVVGRARMGGIPLGVIAVDTRTIETVIPADPANPASTETLIQEAGL
VWYPNSAFKTAQAIADFNHGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVDYK
QPVFVYIPPTGELRGGSWVVVDPTINSDQMEMYADSDSRAGVLEPAGMVGIKYRREKLLK
TMERLDAKYKELKDSLSDSSLSSEEHQKLANELAAREKLLLPIYQQVSIQFAGLHDKAGR
MLAKGVIRKELQWVNARRFFFWRLRRRLNEEYLIRRLESELPNASRLEKFARLRSWYPAS
VDQENDQQVATWIEENYQVLEDYLQALKLESFAQNLAKAIRSDHDNAITGLAEVLKLLSA
EDKEKIMKSLK
NT seq 6696 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagggagttttacagaggccatggagtcacagaaacggtacgagttcacagac
tactcggccaagcacgcccggctagcgcctcacttcatcggtctgaataccgtggaacag
gcggaggcgtcgccgctgcgcgactacgtgcggcttcacggcggccacacggtcatctcg
aagatcctgattgcgaacaacgggattgctgcggtaaaagagatcagatcagtgcgtaag
tgggcgtatgagacgttcggggacggaaaagttgttcagtttgttgtcatggcaacaccg
gaagatctagaggcgaataccgagtatattcgcatggccgaccagtacgtggaggtaccc
ggcggcacaaataacaataactacgcaaatgtcgacctgatcgtcgatgttgcagagcgt
gctgacgttgatgcagtttgggccggatggggtcacgcttcggagaatccgctccttcct
gagaagctggcccggtcgaagcggaaggtagtgttcattggccctccagggagcgctatg
cgctctttgggagataaaatttcttccacgattgtcgcacaacacgccaaggtgccctgc
atcccatggtcgggtactggcgtggaccaggtcgaaatagatccgcacactaagctcgta
tcggttgcggacgatatctaccagaaggggtgctgcttgtcccccgaagatggcctaaac
aaggctaaacagatcggctttccagttatggtgaaggcatctgaaggtggcggaggtaag
ggtattcgtaaggttgtgagggaggaagactttatttctctgtaccagcaggctgcaaat
gaaataccaggatctcctatttttattatgaagttggcaggaaaggctcgtcatctagag
gttcaactgctggccgaccaatatggtacaaatatctccctatttggtcgcgactgctct
gttcaacggcggcaccagaagattatagaagaagccccagtgacgatcgctaaaccagat
acgtttgccgaaatggagagggctgcagtgagattgggtaaattagtcggctacgtttct
gcgggaacagttgagtacctatattcgcacgaagaagacaagttctatttccttgagctg
aatccaagacttcaggtggaacatcctaccaccgaaatggtcacaggtgtaaatttgcct
gcagcacagcttcagatcgcaatgggcataccgctgcatagaatcagagatatacgctta
ttctacggccttgacccacatactgctacagagattgattttgagttttcttcagcggat
gctttgcagacgcaaagaaggcccatccccaagggccactgtacagcatgtagaataacg
tcagaggatccaaatgagggtttcaaaccgtcgggtggctctttacacgagttgaacttc
cgttcctcttccaacgtctggggttatttttctgttggtaacaacggtggaattcattca
ttctctgattcgcaatttggccacatctttgcgtttggtgagaacaggcaggcatcgagg
aaacacatggttgttgctttaaaggaattatccataagaggtgactttagaactacagtg
gaatatctaataaaactgcttgagactgaagattttgaggataacactattactactggt
tggttggatgatttgatctctcaaaagatttcagccgaaaaaccggatcctatgttggcg
gtaatctgtggcgctaccaccaaggcgcacattgcatcagagcaagcgctgcaggaatat
gcatcctatctcaagcgtggtcaagttcctaataagaacatgctgaaaacgatgtatcct
gttgagtttatacacgaagagaagaggtataaattcaccgtcgcgaagtccgctgatgat
aggtataatcttttcatcaatggatctaggtgcgaagttggtcttcggaaattgtcagat
ggcgggctattgatagctgctggtggtaagtcccatacagtttactggaaagaggaagtc
gctgcaacaagactgtctatagaccaccagacaacgctgttggagacagagaacgatccc
acgcagctgcggactccgtcgccgggtaagttagtgaactttttggtcgaatcaggcgat
catctcgaggcaggccaaccgtatgctgagatcgaggtcatgaaaatgcaaatgcctctc
atcgcccaggagagcggtgtcctgcaactactaaggcaacctggctctacgttggccgct
ggtgacattctagccattttaacgcttgatgatcctagtaaggtaaaatatgccatgcct
tttgaaggtatgcttcctgatcttggtgccccagtgattgaaggaacgaagccagcgtac
aaattcagatctctagtttcgaccctagagaatgtcttaaaaggctacgacaatcaagtg
attatgaatgcgtcattacaaaagctaatagaggtccttagagacccgcagttaccttat
tcagagtggaaaatgcaagtatctgctttacactccaggttaccacaggccttggatcag
caattagagcaattggtcgagcgttgccataaaaggtctgcggatttccctgcaaagcag
ctgggaaagattttagaaaacgctatcaacgagcggaaatcagacccattgttccagact
gttgtggaacccttgacaagtatcacaactcgttacaagactgggttacaggaccatgag
cacgccgttttgggaagctttttggaaaattactattcagttgagaagctattctctggc
tctaaggttaatgaagaggatgttatcctcaagttacgggatgaaaacgccgatgaccta
aataaggtagtcatgactgtcctttcacattctcgtgtttctgcgaagaataatttgata
tctgccattctaaagcattaccgtcctctatgcaaattatcatccgaggtggcggctaag
atatctgttcccttgaaacatatcgttcagttggaatccaaagcaactgctaaggtagcc
cttcaagcaagggagatattgattcaggcagctctaccttcggtcagagaaaggacagaa
caactagagcacatattgaaaagttctgtggttaagcctacttatggtgctaccgagatg
aaccatacggatccgaacattgaggttttgaaagacctcattgattccaattacgtggta
tttgacgttttgactcaatttttaaatcacagggataaatatgtgattgcagcagcagca
gaagtttacattcgccgggcctatagagtctataccgtcggtgatatcaagtaccattct
ggctttgatactccaatttttgaatggaagttccaattgccatctgctgccttcacttcg
cgcccgcaggttacttcgaggctgggtgtgaacagagctatttccatctcagatttgaca
tacgtatctgaggctgaaaaccaaccttctagaacaggactactagtgcccgccccacat
ttggatgatgtcgactctattctatcgaatgctctgagcgtaattcctatgcaattgtcc
cattccggtcctttgccagataggtctgcggcggctaacccatcattgtcaaatgtagta
aatgtggtaatttcttctacggaaggtttcgactccgaggcagaagttttggacagattg
aaggaaattttggagctaaataaaagcgaacttctcgcttcagcaatcagacgcattaca
tttgtctttggatacagggatggctcttatccaaagtactatactttcaggggatctgac
tatgtcgaagataaaactattcgtcacattgaaccagcactagcctaccagttggagttg
ggtagaatgtcaaatttccacattaagcctatcttcacagaaaatagaaatatccatgtc
tatgaagcgataggtaaaaactcacctgttgataaacgttttttcaccagaggcattatt
aggacgggccgcatcagggatgatatcactattcaagaatatttgacttctgaagcgaat
agattaatgagtgatattttggataacttggaggtcactgatacctctaattcagactta
aaccatatctttatcaatttctctgccgtctttgacgtttcgccagcagacgttgaggca
gcgtttggaggcttcttggaaagatttggtaagagacttctaaggcttcgtgttgctgcg
gcagaaattcgtatcatgataaaggatccgggatctgggactccggttgccctaagagcg
ttaattaataacgtttctggttacgttgtgagaactgaattgtatactgaggttaagaat
gcgaacggagatagaattttcaaatcattggataagcctggttcgatgcacttgaggcca
attgcaacgccatatcctgtgaaggaatggctacagccaaaacgttacaaggctcatttg
atgggtactacgtacgtgtatgacttcccagaactgttccggcaagctacattaagccaa
tggaggaaacattcgccgaagatgcagttatccgatgatttcttcattgcgaatgagttg
atctctgacgagaatggtgaactaacagaagttgaccgcgagcccggtactaatagtatt
ggtatggtagctttcaaggttactgttaagacacctgaatatccccatggccggcaattc
gttattatcgctaacgatattacctacatgattgggtcctttgggccacaagaagatgaa
ttctttgagaaagttaccaactatgctagaaagcgtggtattcccagaatttatctgtca
gcgaactcaggagcaagaattggtattgctgaagaacttgttccaatgttctccgtggct
tggaagacccctggtaatcctgaaaaaggctttgactatctatatttcacgacagaaatg
tatgaaacgttgaagcagtctggtaaagaaaatgtcgtaattactgaaagaattgtggaa
gatggagaagagagatacgccatcaaggcaatcataggatcagaagatggtctaggtgtt
gagtgtctaaggggttctggcttgattgcaggtgcaacctcaaaagcatacaaggatatt
tttacgataaccttagtgacatgcagatcggtaggtattggcgcttatttggtcagatta
ggccagcgtgcgatccaagtggaaggacaacctataattctaacaggtgcacctgctatt
aacaaagttcttggcaaggaagtttactcttctaacttgcaactaggtggcacacaaatt
atgtacaacaacggtgtgtcccacttgaccgcgcaggatgatctagcaggtgttgaacag
ataatggaatggctctcctatattccagctaaacgtaatatgcccgtacctatactgcag
tcagaggacaactgggatagggatgttgaatacacaccaacactttcacagccttatgat
gtacgctggatgattgaaggccgccaaggacctgatggatttgaatatggtctgtttgac
aagggttccttccaggaaacattatcaggctgggcgagaggcgtcgttgtaggcagagct
cgcatgggtggtatcccgctcggtgttattgccgttgacactcgtacaattgaaactgtg
atccctgccgatccggcaaaccctgcatccacagaaactttgattcaggaggcaggctta
gtttggtatcctaactcagcatttaaaactgcgcaggccatagctgatttcaaccacgga
gaacaacttccactcatgatattagcaaactggagagggttttctggtggtcaaagagat
atgtacaatgaggtcttgaaatatggctccttcattgttgatgctctagtggattataaa
cagcctgtattcgtatacatacctccaacaggtgagttgagaggtggttcctgggttgtg
gtggatcctacaattaactctgaccagatggagatgtatgctgattccgactcgcgggca
ggtgtgctagaacctgctggtatggttggtataaagtacaggagagaaaagcttttgaaa
acaatggagaggttagatgcaaagtacaaagaattgaaggattccttgtcagattcatca
ctctcctctgaggaacatcagaagctcgccaacgagttggctgcccgtgagaagctactc
ttgccaatttaccagcaagtcagtatccaatttgcaggcttacacgataaggcaggcaga
atgctggcgaaaggcgtgatcagaaaggaactacaatgggtgaatgcgagacgtttcttc
ttctggagactcaggagaagattaaatgaggaatacctcattagaagactcgaatcggag
ctacctaacgccagtagactggagaagttcgcaagactaagatcctggtaccctgcttct
gtggaccaggaaaacgaccaacaggtcgccacctggatcgaagaaaactaccaagtcttg
gaagattacttgcaggctttgaagttggaatcatttgcccaaaacctcgccaaggccatc
cgtagtgatcacgacaacgcgataacaggtctcgctgaagttttgaagctactctcggcg
gaggataaggaaaagataatgaagagtctgaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system