KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AAR071WHelp
Entry
AGOS_AAR071W      CDS       T00167                                 

Definition
(RefSeq) AAR071Wp
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AGOS_AAR071W
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AGOS_AAR071W
   00640 Propanoate metabolism
    AGOS_AAR071W
  Lipid metabolism
   00061 Fatty acid biosynthesis
    AGOS_AAR071W
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    AGOS_AAR071W
Enzymes [BR:ago01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     AGOS_AAR071W
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     AGOS_AAR071W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:466766..473461
Genome map
AA seq 2231 aa AA seqDB search
MSEGSFTEAMESQKRYEFTDYSAKHARLAPHFIGLNTVEQAEASPLRDYVRLHGGHTVIS
KILIANNGIAAVKEIRSVRKWAYETFGDGKVVQFVVMATPEDLEANTEYIRMADQYVEVP
GGTNNNNYANVDLIVDVAERADVDAVWAGWGHASENPLLPEKLARSKRKVVFIGPPGSAM
RSLGDKISSTIVAQHAKVPCIPWSGTGVDQVEIDPHTKLVSVADDIYQKGCCLSPEDGLN
KAKQIGFPVMVKASEGGGGKGIRKVVREEDFISLYQQAANEIPGSPIFIMKLAGKARHLE
VQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFAEMERAAVRLGKLVGYVS
AGTVEYLYSHEEDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPLHRIRDIRL
FYGLDPHTATEIDFEFSSADALQTQRRPIPKGHCTACRITSEDPNEGFKPSGGSLHELNF
RSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTTV
EYLIKLLETEDFEDNTITTGWLDDLISQKISAEKPDPMLAVICGATTKAHIASEQALQEY
ASYLKRGQVPNKNMLKTMYPVEFIHEEKRYKFTVAKSADDRYNLFINGSRCEVGLRKLSD
GGLLIAAGGKSHTVYWKEEVAATRLSIDHQTTLLETENDPTQLRTPSPGKLVNFLVESGD
HLEAGQPYAEIEVMKMQMPLIAQESGVLQLLRQPGSTLAAGDILAILTLDDPSKVKYAMP
FEGMLPDLGAPVIEGTKPAYKFRSLVSTLENVLKGYDNQVIMNASLQKLIEVLRDPQLPY
SEWKMQVSALHSRLPQALDQQLEQLVERCHKRSADFPAKQLGKILENAINERKSDPLFQT
VVEPLTSITTRYKTGLQDHEHAVLGSFLENYYSVEKLFSGSKVNEEDVILKLRDENADDL
NKVVMTVLSHSRVSAKNNLISAILKHYRPLCKLSSEVAAKISVPLKHIVQLESKATAKVA
LQAREILIQAALPSVRERTEQLEHILKSSVVKPTYGATEMNHTDPNIEVLKDLIDSNYVV
FDVLTQFLNHRDKYVIAAAAEVYIRRAYRVYTVGDIKYHSGFDTPIFEWKFQLPSAAFTS
RPQVTSRLGVNRAISISDLTYVSEAENQPSRTGLLVPAPHLDDVDSILSNALSVIPMQLS
HSGPLPDRSAAANPSLSNVVNVVISSTEGFDSEAEVLDRLKEILELNKSELLASAIRRIT
FVFGYRDGSYPKYYTFRGSDYVEDKTIRHIEPALAYQLELGRMSNFHIKPIFTENRNIHV
YEAIGKNSPVDKRFFTRGIIRTGRIRDDITIQEYLTSEANRLMSDILDNLEVTDTSNSDL
NHIFINFSAVFDVSPADVEAAFGGFLERFGKRLLRLRVAAAEIRIMIKDPGSGTPVALRA
LINNVSGYVVRTELYTEVKNANGDRIFKSLDKPGSMHLRPIATPYPVKEWLQPKRYKAHL
MGTTYVYDFPELFRQATLSQWRKHSPKMQLSDDFFIANELISDENGELTEVDREPGTNSI
GMVAFKVTVKTPEYPHGRQFVIIANDITYMIGSFGPQEDEFFEKVTNYARKRGIPRIYLS
ANSGARIGIAEELVPMFSVAWKTPGNPEKGFDYLYFTTEMYETLKQSGKENVVITERIVE
DGEERYAIKAIIGSEDGLGVECLRGSGLIAGATSKAYKDIFTITLVTCRSVGIGAYLVRL
GQRAIQVEGQPIILTGAPAINKVLGKEVYSSNLQLGGTQIMYNNGVSHLTAQDDLAGVEQ
IMEWLSYIPAKRNMPVPILQSEDNWDRDVEYTPTLSQPYDVRWMIEGRQGPDGFEYGLFD
KGSFQETLSGWARGVVVGRARMGGIPLGVIAVDTRTIETVIPADPANPASTETLIQEAGL
VWYPNSAFKTAQAIADFNHGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVDYK
QPVFVYIPPTGELRGGSWVVVDPTINSDQMEMYADSDSRAGVLEPAGMVGIKYRREKLLK
TMERLDAKYKELKDSLSDSSLSSEEHQKLANELAAREKLLLPIYQQVSIQFAGLHDKAGR
MLAKGVIRKELQWVNARRFFFWRLRRRLNEEYLIRRLESELPNASRLEKFARLRSWYPAS
VDQENDQQVATWIEENYQVLEDYLQALKLESFAQNLAKAIRSDHDNAITGLAEVLKLLSA
EDKEKIMKSLK
NT seq 6696 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagggagttttacagaggccatggagtcacagaaacggtacgagttcacagac
tactcggccaagcacgcccggctagcgcctcacttcatcggtctgaataccgtggaacag
gcggaggcgtcgccgctgcgcgactacgtgcggcttcacggcggccacacggtcatctcg
aagatcctgattgcgaacaacgggattgctgcggtaaaagagatcagatcagtgcgtaag
tgggcgtatgagacgttcggggacggaaaagttgttcagtttgttgtcatggcaacaccg
gaagatctagaggcgaataccgagtatattcgcatggccgaccagtacgtggaggtaccc
ggcggcacaaataacaataactacgcaaatgtcgacctgatcgtcgatgttgcagagcgt
gctgacgttgatgcagtttgggccggatggggtcacgcttcggagaatccgctccttcct
gagaagctggcccggtcgaagcggaaggtagtgttcattggccctccagggagcgctatg
cgctctttgggagataaaatttcttccacgattgtcgcacaacacgccaaggtgccctgc
atcccatggtcgggtactggcgtggaccaggtcgaaatagatccgcacactaagctcgta
tcggttgcggacgatatctaccagaaggggtgctgcttgtcccccgaagatggcctaaac
aaggctaaacagatcggctttccagttatggtgaaggcatctgaaggtggcggaggtaag
ggtattcgtaaggttgtgagggaggaagactttatttctctgtaccagcaggctgcaaat
gaaataccaggatctcctatttttattatgaagttggcaggaaaggctcgtcatctagag
gttcaactgctggccgaccaatatggtacaaatatctccctatttggtcgcgactgctct
gttcaacggcggcaccagaagattatagaagaagccccagtgacgatcgctaaaccagat
acgtttgccgaaatggagagggctgcagtgagattgggtaaattagtcggctacgtttct
gcgggaacagttgagtacctatattcgcacgaagaagacaagttctatttccttgagctg
aatccaagacttcaggtggaacatcctaccaccgaaatggtcacaggtgtaaatttgcct
gcagcacagcttcagatcgcaatgggcataccgctgcatagaatcagagatatacgctta
ttctacggccttgacccacatactgctacagagattgattttgagttttcttcagcggat
gctttgcagacgcaaagaaggcccatccccaagggccactgtacagcatgtagaataacg
tcagaggatccaaatgagggtttcaaaccgtcgggtggctctttacacgagttgaacttc
cgttcctcttccaacgtctggggttatttttctgttggtaacaacggtggaattcattca
ttctctgattcgcaatttggccacatctttgcgtttggtgagaacaggcaggcatcgagg
aaacacatggttgttgctttaaaggaattatccataagaggtgactttagaactacagtg
gaatatctaataaaactgcttgagactgaagattttgaggataacactattactactggt
tggttggatgatttgatctctcaaaagatttcagccgaaaaaccggatcctatgttggcg
gtaatctgtggcgctaccaccaaggcgcacattgcatcagagcaagcgctgcaggaatat
gcatcctatctcaagcgtggtcaagttcctaataagaacatgctgaaaacgatgtatcct
gttgagtttatacacgaagagaagaggtataaattcaccgtcgcgaagtccgctgatgat
aggtataatcttttcatcaatggatctaggtgcgaagttggtcttcggaaattgtcagat
ggcgggctattgatagctgctggtggtaagtcccatacagtttactggaaagaggaagtc
gctgcaacaagactgtctatagaccaccagacaacgctgttggagacagagaacgatccc
acgcagctgcggactccgtcgccgggtaagttagtgaactttttggtcgaatcaggcgat
catctcgaggcaggccaaccgtatgctgagatcgaggtcatgaaaatgcaaatgcctctc
atcgcccaggagagcggtgtcctgcaactactaaggcaacctggctctacgttggccgct
ggtgacattctagccattttaacgcttgatgatcctagtaaggtaaaatatgccatgcct
tttgaaggtatgcttcctgatcttggtgccccagtgattgaaggaacgaagccagcgtac
aaattcagatctctagtttcgaccctagagaatgtcttaaaaggctacgacaatcaagtg
attatgaatgcgtcattacaaaagctaatagaggtccttagagacccgcagttaccttat
tcagagtggaaaatgcaagtatctgctttacactccaggttaccacaggccttggatcag
caattagagcaattggtcgagcgttgccataaaaggtctgcggatttccctgcaaagcag
ctgggaaagattttagaaaacgctatcaacgagcggaaatcagacccattgttccagact
gttgtggaacccttgacaagtatcacaactcgttacaagactgggttacaggaccatgag
cacgccgttttgggaagctttttggaaaattactattcagttgagaagctattctctggc
tctaaggttaatgaagaggatgttatcctcaagttacgggatgaaaacgccgatgaccta
aataaggtagtcatgactgtcctttcacattctcgtgtttctgcgaagaataatttgata
tctgccattctaaagcattaccgtcctctatgcaaattatcatccgaggtggcggctaag
atatctgttcccttgaaacatatcgttcagttggaatccaaagcaactgctaaggtagcc
cttcaagcaagggagatattgattcaggcagctctaccttcggtcagagaaaggacagaa
caactagagcacatattgaaaagttctgtggttaagcctacttatggtgctaccgagatg
aaccatacggatccgaacattgaggttttgaaagacctcattgattccaattacgtggta
tttgacgttttgactcaatttttaaatcacagggataaatatgtgattgcagcagcagca
gaagtttacattcgccgggcctatagagtctataccgtcggtgatatcaagtaccattct
ggctttgatactccaatttttgaatggaagttccaattgccatctgctgccttcacttcg
cgcccgcaggttacttcgaggctgggtgtgaacagagctatttccatctcagatttgaca
tacgtatctgaggctgaaaaccaaccttctagaacaggactactagtgcccgccccacat
ttggatgatgtcgactctattctatcgaatgctctgagcgtaattcctatgcaattgtcc
cattccggtcctttgccagataggtctgcggcggctaacccatcattgtcaaatgtagta
aatgtggtaatttcttctacggaaggtttcgactccgaggcagaagttttggacagattg
aaggaaattttggagctaaataaaagcgaacttctcgcttcagcaatcagacgcattaca
tttgtctttggatacagggatggctcttatccaaagtactatactttcaggggatctgac
tatgtcgaagataaaactattcgtcacattgaaccagcactagcctaccagttggagttg
ggtagaatgtcaaatttccacattaagcctatcttcacagaaaatagaaatatccatgtc
tatgaagcgataggtaaaaactcacctgttgataaacgttttttcaccagaggcattatt
aggacgggccgcatcagggatgatatcactattcaagaatatttgacttctgaagcgaat
agattaatgagtgatattttggataacttggaggtcactgatacctctaattcagactta
aaccatatctttatcaatttctctgccgtctttgacgtttcgccagcagacgttgaggca
gcgtttggaggcttcttggaaagatttggtaagagacttctaaggcttcgtgttgctgcg
gcagaaattcgtatcatgataaaggatccgggatctgggactccggttgccctaagagcg
ttaattaataacgtttctggttacgttgtgagaactgaattgtatactgaggttaagaat
gcgaacggagatagaattttcaaatcattggataagcctggttcgatgcacttgaggcca
attgcaacgccatatcctgtgaaggaatggctacagccaaaacgttacaaggctcatttg
atgggtactacgtacgtgtatgacttcccagaactgttccggcaagctacattaagccaa
tggaggaaacattcgccgaagatgcagttatccgatgatttcttcattgcgaatgagttg
atctctgacgagaatggtgaactaacagaagttgaccgcgagcccggtactaatagtatt
ggtatggtagctttcaaggttactgttaagacacctgaatatccccatggccggcaattc
gttattatcgctaacgatattacctacatgattgggtcctttgggccacaagaagatgaa
ttctttgagaaagttaccaactatgctagaaagcgtggtattcccagaatttatctgtca
gcgaactcaggagcaagaattggtattgctgaagaacttgttccaatgttctccgtggct
tggaagacccctggtaatcctgaaaaaggctttgactatctatatttcacgacagaaatg
tatgaaacgttgaagcagtctggtaaagaaaatgtcgtaattactgaaagaattgtggaa
gatggagaagagagatacgccatcaaggcaatcataggatcagaagatggtctaggtgtt
gagtgtctaaggggttctggcttgattgcaggtgcaacctcaaaagcatacaaggatatt
tttacgataaccttagtgacatgcagatcggtaggtattggcgcttatttggtcagatta
ggccagcgtgcgatccaagtggaaggacaacctataattctaacaggtgcacctgctatt
aacaaagttcttggcaaggaagtttactcttctaacttgcaactaggtggcacacaaatt
atgtacaacaacggtgtgtcccacttgaccgcgcaggatgatctagcaggtgttgaacag
ataatggaatggctctcctatattccagctaaacgtaatatgcccgtacctatactgcag
tcagaggacaactgggatagggatgttgaatacacaccaacactttcacagccttatgat
gtacgctggatgattgaaggccgccaaggacctgatggatttgaatatggtctgtttgac
aagggttccttccaggaaacattatcaggctgggcgagaggcgtcgttgtaggcagagct
cgcatgggtggtatcccgctcggtgttattgccgttgacactcgtacaattgaaactgtg
atccctgccgatccggcaaaccctgcatccacagaaactttgattcaggaggcaggctta
gtttggtatcctaactcagcatttaaaactgcgcaggccatagctgatttcaaccacgga
gaacaacttccactcatgatattagcaaactggagagggttttctggtggtcaaagagat
atgtacaatgaggtcttgaaatatggctccttcattgttgatgctctagtggattataaa
cagcctgtattcgtatacatacctccaacaggtgagttgagaggtggttcctgggttgtg
gtggatcctacaattaactctgaccagatggagatgtatgctgattccgactcgcgggca
ggtgtgctagaacctgctggtatggttggtataaagtacaggagagaaaagcttttgaaa
acaatggagaggttagatgcaaagtacaaagaattgaaggattccttgtcagattcatca
ctctcctctgaggaacatcagaagctcgccaacgagttggctgcccgtgagaagctactc
ttgccaatttaccagcaagtcagtatccaatttgcaggcttacacgataaggcaggcaga
atgctggcgaaaggcgtgatcagaaaggaactacaatgggtgaatgcgagacgtttcttc
ttctggagactcaggagaagattaaatgaggaatacctcattagaagactcgaatcggag
ctacctaacgccagtagactggagaagttcgcaagactaagatcctggtaccctgcttct
gtggaccaggaaaacgaccaacaggtcgccacctggatcgaagaaaactaccaagtcttg
gaagattacttgcaggctttgaagttggaatcatttgcccaaaacctcgccaaggccatc
cgtagtgatcacgacaacgcgataacaggtctcgctgaagttttgaagctactctcggcg
gaggataaggaaaagataatgaagagtctgaagtag

DBGET integrated database retrieval system