KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ABL033CHelp
Entry
AGOS_ABL033C      CDS       T00167                                 

Definition
ABL033Cp
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:ago01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ago00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ago00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ago00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(337878..338999)
Genome map
AA seq 373 aa AA seqDB search
MLRLLNPRSTQTVSRATRLVIRLSSTAIPTTQKAVVFYEHGGELKYTDIPVPKPKPNEIL
VNIKYSGVCHTDLHAWKGDWAIKPKLPLVGGHEGAGVVVAKGANVTNFEIGDYAGVKWLG
KTCMECEFCQKGFEPNCETPTLSGYTHDGTFQQYATADAIHAAHIPPGTDLAKVAPILCA
GITVYKALKTAALIPGQWVAISGAGGGLGSLAVQYAVAMGYRVVGIDGGNEKEALFRSLG
GETFVDFHKNKDIVSAVREATGGGPHGVVNVSVSTNAILQSVEYVRPTGTVVLVGLPPDA
TVKSDVLTHVLKSINIKGSYVGNRADTKEAIEFFTRGLVQSPIKIIGLSQLEEAYKAMEE
GTSIGRYVVDTSR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcttagactactcaaccccagatctacccagactgttagcagggccaccaggctcgtg
atacgcttaagctccaccgctatacccacgacgcagaaggcggtggtgttctatgagcat
ggtggtgaactcaagtacaccgacattcctgttccgaagccaaaaccaaacgaaattcta
gttaatattaagtattcaggcgtgtgccacacggacttacacgcatggaagggtgactgg
gcaataaaacccaaattgcctcttgttggcggacacgagggtgctggtgtcgttgttgct
aagggtgcaaatgtcaccaacttcgagattggtgactacgctggtgttaagtggttgggc
aaaacctgtatggagtgtgagttctgtcagaagggctttgagcccaactgtgagacccca
accctttcgggttacacacatgacggcactttccagcagtacgccactgctgacgcaatt
cacgcagcccatattccacctggcacagatcttgccaaggtagcgccaatactctgcgca
gggattactgtttacaaggcactgaagacggctgcgcttattcctggtcagtgggttgca
atttcgggtgctggaggtggcttgggctccctagccgtccagtacgctgttgccatgggg
tacagggttgttggtattgacggaggtaacgaaaaggaggcactcttcaggagcttgggt
ggtgagacatttgttgattttcataagaacaaggatattgtcagtgctgtccgtgaggcc
accggtggtggaccccatggcgtagttaatgtatctgtgtcgactaatgcaattctgcaa
tcagtggagtatgtcagacctactggaactgtagttttggttggtcttccgccagatgct
actgtgaagtcggatgttctcacccacgtcttgaagagcatcaacatcaagggttcttat
gtaggtaaccgtgcggataccaaagaggcaatagaattcttcaccagaggtctggttcag
tcacccatcaaaataatcggcttatcgcaacttgaggaggcctataaggcaatggaggag
ggtacgtctattgggcgttatgtcgttgatacttctagataa

DBGET integrated database retrieval system