KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ABL085WHelp
Entry
AGOS_ABL085W      CDS       T00167                                 

Definition
ABL085Wp
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:ago00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:237995..240268
Genome map
AA seq 757 aa AA seqDB search
MASKKSQKAASVERDDSAAKRGKAEGRYEYMGERWLQRPAPDSNLKYKYYGYMVTAIAFA
VRFHKLYHPSEVVFDEVHFGKFASYYLERTYFFDVHPPFSKMLIAFVGWLVGYDGAFKFD
DIGYSYETHQVPYIAYRSLSAILGTLTVPLVFSILRELNFKAITCAFGALLVAVDNAHVI
DSRLILLDATLVISVALSIYTYIRFYKAQLRAPLSSEWYFWLYATGLSLSFVISTKYVGV
FTFAMIGTAVIVNLWQLLDVRAGLSLRMFFRHFVQRFNGLVCFPFAVYLFWFYVHFAILT
KSGPGDDFMSSAFQETLADSPLAKDSKDVHYYDIVTFQHRDTGALLHSHNAYYPLRYEDG
RVSSQGQQVTGYSHEDINNQWEILPTKELSSRTGQPVLLDDVLRLRHIATGTYLLTHDVA
SPYYPTNEEVTTISEELANGERYKQTLFKLQPPNKKDGGHTVKSKTSMFRMFHVDTAVAL
WTHNDVFLPEWGFKQQEVNGNKKVTDPANIWTVNSILNLSEERKVYIPKKVTKMPFFSKW
LELQRSMFEHNNKLSSEHPFASQPESWPGSLSGVSFWTNDTERRQIYFTGNIIGWWIELI
SLALFVGILLADAITRQRSFFVLGKLAREKIYGPLCFLYIGWAIHYFPFFLMGRQKFLHH
YLPAHLIAAMFTAGLWEVIFTDNRALTTRKDESEPAAPHNTNPIVYEYFLLAFLGLLSIA
VVGFFIYFSPIVYGDRTLTPEEVIKRQWFDIKLHFAK
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctaaaaagtcgcagaaagctgctagtgtagaacgtgatgactcggcggcgaag
cggggcaaggccgagggacggtatgagtacatgggcgagcggtggctccagaggccggca
ccggattccaacctgaaatacaagtactatggatacatggtgacggcgattgcgtttgcg
gttcggtttcacaagctgtaccatcctagcgaggtggtgtttgacgaggtgcactttggt
aagtttgcgtcgtactacctggagcgcacgtacttcttcgacgtgcacccgccgttctct
aagatgttgattgcatttgtgggctggctggtggggtatgacggggcgttcaagtttgac
gacatcggatacagctacgagacgcaccaagtcccctacattgcgtacaggtctctgagc
gcgatcctggggacgctgactgtgccgctggtgttcagcattctgcgagagctgaatttc
aaggcgattacatgcgcttttggtgcattgttagtggccgttgacaacgcacatgtgatc
gattcgagattgattttgcttgatgcgacgctagtgatctcagttgcgttgtcgatatac
acctatatccgcttctacaaggcacaactgcgcgctccattgtcctctgagtggtacttc
tggctttacgccaccggtttgtcgctgtcgttcgtgatctccacgaaatacgttggtgtg
ttcacctttgccatgattggtaccgccgtaatcgttaatctgtggcagctgctcgacgtg
agagcagggttgtcacttcgtatgttcttcaggcacttcgttcagcggtttaacggcttg
gtttgtttcccatttgcggtatacctcttctggttctacgttcatttcgccatcctaacc
aagtctggtcccggtgacgactttatgtcttctgcgttccaagagacgctcgccgattca
cctcttgccaaggactcgaaggatgtccattactacgacattgttaccttccagcatcgg
gacactggtgctctgctacactcacacaacgcctactatccgctgcgttatgaagatggc
cgcgtatcttctcagggccaacaggtcactggctacagtcatgaagatatcaacaaccag
tgggagatattacctacaaaggagttgtcgtcaaggaccggccagcccgttcttctagat
gatgtgctacgactaagacatatcgccactggtacatatctattgacacatgacgttgct
tccccctactatcctacgaacgaagaggttacgacgatatctgaggagctagcaaatgga
gagcgctacaagcagacgttgttcaaactgcagcctccaaataaaaaagatgggggccat
acggtcaagagtaagacttcgatgttcagaatgttccatgttgacactgcagtggcttta
tggacccataacgacgtctttttgccagaatggggattcaagcagcaggaagttaacggg
aacaagaaagtgaccgatccagctaatatttggactgtgaattccatcctaaacttgagt
gaagaaagaaaagtctacatccctaagaaagtcaccaaaatgcctttcttctccaagtgg
ctggagttgcagcgttctatgttcgaacataacaataagctgtcttctgaacatccgttt
gcttcacaaccggaatcctggccagggtctctatcaggcgtatcattctggacaaatgac
accgaacgccggcaaatatatttcacgggaaacatcatcggatggtggatcgaactaatc
tccctggctttattcgtcggtattctcttggctgatgccattactagacagcgcagcttt
ttcgtgttgggtaaactggccagagagaagatctacgggcctctgtgcttcctgtacatc
gggtgggcaatccactatttcccgttcttcctaatgggccgccagaaattccttcaccac
tacctgccagctcacctcattgcggccatgtttaccgcagggctgtgggaggtgatcttc
accgacaatagagctttaacgacccggaaggatgagtcggagccagctgctcctcacaac
acgaaccctattgtgtacgagtacttccttttggcgtttttaggcttactgtctatcgcc
gttgtgggatttttcatttatttcagcccaattgtgtatggcgacaggacgctgacaccc
gaggaagttattaagagacagtggtttgacataaagctacactttgctaaatga

DBGET integrated database retrieval system