KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ABR009WHelp
Entry
AGOS_ABR009W      CDS       T00167                                 

Definition
ABR009Wp
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ago00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:408451..409692
Genome map
AA seq 413 aa AA seqDB search
MAENSLLKPPSLSRKRSSSVGNIGLGDTKVPGLSTMSESKESKIAARARLRALSGASKTD
IDIYYKLWLSYRELNYRHAWLTPLIILFLIYSCYFASGNRTESNPLHMFVAISYRVGNTN
MYGKGVKDMCFVFYYMVFFTFLREFMMEMVLRPLTFRLGVTKPHKVKRMMEQAYSTFYYG
LSGPFGLFVMYRTDLWLFKTAEMYKTYPDLTNEYYYKIFYLGQAAFWAQQACILVLQLEK
PRKDFRELVFHHIVTLALISLSYVFHFTKMGLAVYITMDVSDFFLALSKIFNYMESSFTA
PLFLLFVSSWVYLRHYVNIKILWSVLTEFRTVGDYTLNFATEQYKSWIALPIVFGLIFAL
HLVNLYWLALIFRILYRMLFQGVQKDERSDSESEDNEEELDDSSDETDKKKNQ
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaattcgttattgaagccaccatcgctctcccggaagcggagttcctctgtg
gggaacattggtcttggtgatacaaaagtgcctgggctatccacgatgtctgaatcgaaa
gaatccaagattgccgcgagggcgcggttgcgggcactttctggagcatcgaagacggat
atcgacatctactacaagctgtggctatcgtatagagagctgaattatcgtcacgcgtgg
ctgactcctctgattatcctgtttctgatttatagctgttattttgcttccggcaacagg
acagagagtaacccacttcatatgttcgttgcgatatcttatagagttggcaacacgaac
atgtacgggaaaggtgtcaaagacatgtgctttgtgttctactacatggtattcttcacc
tttctgcgcgaatttatgatggagatggtgttgcgcccattgacgttccggctcggtgtc
accaagccacacaaggtcaagcgtatgatggagcaagcttattccacgttctactatggt
ctttctggtccctttgggttgtttgtgatgtaccgtaccgatctgtggttattcaagaca
gcagaaatgtacaagacttatccagacctcaccaacgagtactattataaaatcttctac
ctcggccaagcagctttctgggcgcaacaggcgtgtatcctggttttgcaactagagaag
ccaagaaaggacttcagggaacttgtctttcaccatattgtcaccttggcgctaatttca
ttatcatacgttttccacttcacaaagatgggcctggcagtgtacatcaccatggatgta
tcggattttttcctagccctttcaaagattttcaattacatggagtcttcgttcacagct
ccgttatttcttctatttgtgtcgtcctgggtctatctgagacactacgttaatattaag
atcctctggtctgtgttgacagagttccgtaccgtgggtgactacacattgaacttcgct
accgagcaatacaaaagttggatcgctttgccgattgtttttggtttaatatttgcgttg
catcttgttaatctctattggcttgccctaatattccgtattttataccgcatgctcttc
caaggtgtccaaaaggatgagagaagcgacagtgagtccgaagataatgaagaggagctg
gatgactcatcggatgagactgataagaaaaagaaccaataa

DBGET integrated database retrieval system