KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ACL069CHelp
Entry
AGOS_ACL069C      CDS       T00167                                 

Definition
ACL069Cp
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AGOS_ACL069C
Enzymes [BR:ago01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     AGOS_ACL069C
Exosome [BR:ago04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AGOS_ACL069C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:complement(232439..234373)
Genome map
AA seq 644 aa AA seqDB search
MTLNVVPKGEIPLIAAIDVGTTSTRAILFNKQGQEVSKYQIEYSTTAAKDKEASSPGSAG
SGKGIIFSAEGIAIEANEYVEIEELEHQDATLRFPHPGWVECKPMNILANVVQCFAATLI
SINKVNDERVENNLPPYVIKCIGVTNMRETTIVWSKKTGLPVVDYGIVWNDTRTMDIVNT
KKSETPPEEQERLRAKTGLPPYSTYFSCSKLRWFLDNVPEVLEAYESGDLMFGTVDTWLI
YHLTGNHAFVSDVTNASRTGFMNLDTLDYDDELLEYWGIDRSKLNMPKIVPSAQYYGDFC
VPAVTKKKLTEAAWDVLTSFSQSGIPIQGCLGDQSSSLVGQMAFKAGSAKCTYGTGCFLL
YNTGTKKLLSQHGALTTFGFWFPELEGSEASKPHFVLEGSVAVAGSVVQWLRDNLRLFPR
AEDVGPLASRVPDCGGVVFVPAFSGLFAPYWDAAARGTILGMSQFTTASHIARAAIEGVC
FQARAILKAMSSDAFGEGAKDHDFLEEIVDTGTYEHSPLSVLAVDGGMSKSDEVMQIQAD
ILGPCVKVRRSPTAESTALGAAIAACMAYKDPNERVWKDLNDAKKWIFYGGLEKEEALRT
PDNVSSKLKIFASQSVDTVRRKNWKRWEAAIERTKGWLHDAEGN
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgaacgtggtgccaaaaggggaaattccgctgattgcggccatcgacgtgggg
accacgtcgacccgtgcgatattattcaacaagcagggacaggaggtgtccaagtaccag
atcgagtactccacgacggcagccaaggacaaggaggcgtcgtcgccggggtctgcgggg
tctggtaagggcattattttctctgccgagggtattgccatcgaggcgaacgagtacgtg
gagatcgaggagctggagcaccaggacgccaccttgcgcttcccccaccccggctgggtg
gagtgcaagccgatgaacatcttggccaacgtcgtccagtgctttgccgcgaccttgatc
tcgatcaacaaggtgaacgacgagcgtgtggaaaacaatctgcctccatacgtgatcaag
tgcattggtgtcaccaacatgcgggagaccacgatcgtgtggtctaagaagaccggcttg
ccggtagtggactatggtattgtgtggaacgacacacgtaccatggatatcgtgaacaca
aaaaaaagcgagaccccccctgaggagcaggagcggttgcgtgcgaagacgggtcttccg
ccatactccacgtacttctcgtgctccaagttgcgttggttcttggacaacgtccctgaa
gttctggaagcttacgaaagcggcgacttgatgttcggcaccgtcgacacctggttgatt
taccatctcacaggcaaccatgcgtttgtctccgacgtcaccaatgcatccagaaccggg
ttcatgaacctggacactcttgactacgacgacgaactcctggagtactgggggattgac
aggagcaagctcaacatgccaaagattgtcccgtctgcccagtactatggtgacttctgt
gtccccgccgtgacaaagaagaagttgacagaggctgcctgggacgtgttgacgtccttc
agccagtccggcattccaatccagggctgcttgggtgaccagagctcctctctagtgggc
cagatggcattcaaggccggctctgccaagtgtacgtacggtaccggctgcttcttgttg
tacaacaccggcacaaagaaattgctttcccagcacggtgccttgaccacgttcggtttt
tggttcccggagttggagggctccgaagccagtaagccacatttcgtcttggaaggttcc
gtcgccgtcgccggctctgtggtgcagtggctaagagacaacttgagactatttccaagg
gcggaggacgtcgggccattggccagcagagttccggactgcggcggcgttgttttcgtt
ccggccttcagcggcctattcgctccctactgggacgcagctgcccgtggcaccatattg
ggcatgtcgcagttcaccacggcctcgcacatcgcgcgtgccgcaatcgagggcgtgtgc
ttccaagccagagcgatcttgaaggccatgagctccgacgccttcggcgagggcgccaag
gaccacgacttcttggaggagatcgtcgacacaggcacgtacgagcactcgcccttgtcg
gtcttggccgtcgacggcggcatgtccaagtcagacgaggtcatgcagatccaggccgac
atcttgggtccctgtgtcaaggtcagacgctcgcccaccgcagagagcaccgcattgggc
gccgcaatcgctgcgtgcatggcgtacaaggaccccaacgagcgtgtgtggaaggacctc
aacgacgccaaaaaatggatcttctatggcgggttggaaaaagaggaggccctgcgcact
ccggacaacgtctcctcgaagttgaagatattcgccagccagtccgttgacaccgtccgg
agaaagaactggaagcgctgggaagcggccatcgaaagaaccaagggttggttacacgac
gcagagggcaattaa

DBGET integrated database retrieval system