KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ACL168CHelp
Entry
AGOS_ACL168C      CDS       T00167                                 

Definition
ACL168Cp
Orthology
K05759  
profilin
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
Exosome [BR:ago04147]
 Exosomal proteins
  Proteins found in most exosomes
   AGOS_ACL168C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:complement(join(62414..62781,62841..62853))
Genome map
AA seq 126 aa AA seqDB search
MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG
LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY
LISVQY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcctacactgacaacttgttagcaaccgggaaggtcgacaaggccacc
atctactcgagagcgggtgacacaatttgggcaagctccggcgggcttgccttggaaccc
tcagagatcaaggagatatcccagggctttgacaacgcagcagggttgcaggccaacggg
ttgcacatccagggccagaagttcatgcttttgcgcgcagacgagcgctcgatctacggg
cgccatgaggcggagggcgtcgttgccgtgcgcaccaagcagaccatcctcatcgcgcac
taccccgcgggcgtgcaggctggtgaggccaccaagatcgtggagcagttggccgactac
ttgatcagtgtccagtactaa

DBGET integrated database retrieval system