KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ACR024WHelp
Entry
AGOS_ACR024W      CDS       T00167                                 

Definition
ACR024Wp
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AGOS_ACR024W
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    AGOS_ACR024W
Enzymes [BR:ago01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     AGOS_ACR024W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:400379..403012
Genome map
AA seq 877 aa AA seqDB search
MDLNHAYKASNGESNNSLDSSLDVKPMEKPATDDAVRTEKRKYHGAAVMSHHQISVMSQP
LTKGVRELIKKTTAFMSCSKSKPQKLMELGPMTYAHSVLTASEKPLCHMELESSSVNGFA
DTLQDNGVSDATLVEMWLIRVTRRKRVRYCFRISNGVLTWKDNRMLELDTIKDIRMAEMA
KNYREQYDIMDAFASRWITIIYQVSPTKLKALHLIAPTQLECAKFYNAVLTVARQRRELM
ESISVPSSEAFANIHWKVNVSSKKADESRDTLSFEDVQRLCTKFHIYCSSNYLKRVFKIA
DVNRNGLLNFSEFCTFVRMLKKRHEVTEIWQKIAAETRAIDFEKFYSFLTDVQCEDMDAQ
LARDLFNEYSHEGYMDEDLLLKFLTAQPYAREIEEDYSRPLSEYFISSSHNTYLLGNQVG
SMASVEGYIQALQQGCRSVEIDIWDSDDGPVVCHGKLTSSLPLRNVVDVINKYAFITSPY
PLILSLEIHCRSEGQIIVKQLFDDILGPLIYVADHSVGWPSLRDLKHKIIIKSKKLRVNV
DMAADIYHSTSSKGSSYDSEYDVQSQPSSPMPRRGMRGIHISKRKHRVIEQLLQISAIHG
ITFRNFSLPESKTPTHCFSLSERSFDNLANDDLQRLAIDKHNRRHLMRVYPHAFRYKSSN
YDPIKCWRLGVQMVATNWQTYDLGQQLNQAMFRVTARDDWPWPSGYVRKPEYLLHTVPKT
SFIRDIYEAVHSSVVALSLELLSAQLLPKPKLSSRDGEAHFAPYVVIEVLGDGLCGPIHV
QNGLVTAPNQVTSCRCPENGFNPVWKTSLTATLNNTGFNFIRYIVKNADITLATCCIRLD
YMKRGYRHIPLYSLESSRFIFSTLFVKTDYRIVRSLF
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atggaccttaatcatgcatataaggcaagtaatggggagtctaacaacagccttgattct
tctctggatgtaaaaccgatggagaagccggcaacagatgatgcggtccgcacggagaaa
cgtaagtaccatggtgcggctgtcatgtcccaccaccaaataagtgtgatgtcgcagcct
ctgaccaagggcgtcagagaacttataaagaaaaccacggcgttcatgtcttgctcgaag
agcaagccgcagaaactgatggagctgggcccgatgacgtacgcgcactccgtactgact
gcgagcgagaagcctctctgccacatggagttggagagcagcagcgttaatgggtttgca
gacaccctgcaagacaacggggtgtcggacgcgacgctggtggagatgtggctgatacgg
gtcactcggcgcaaacgcgtgcgctattgcttccggataagtaatggtgtgttgacatgg
aaggacaacaggatgctggagttagatacaatcaaggacattagaatggccgaaatggca
aaaaactacagggaacagtacgatataatggatgcgtttgcgtctcggtggataacgatc
atatatcaggtgtcgcctacgaagctgaaggctctgcatctgatagctccgacgcagctc
gaatgcgcgaagttttataatgccgtgctgactgttgcacggcagcgtcgggagctgatg
gagagtatttctgtccccagcagcgaggcgtttgccaacatccactggaaggtgaatgtg
tcatccaagaaggcagacgaaagcagggatacgctctctttcgaagatgtgcagcgactc
tgcaccaagttccacatatattgctcctccaactatttgaagcgagtttttaaaatagca
gacgtgaatcgcaatgggctgctgaactttagcgagttttgcacctttgtgcggatgcta
aagaagcgccatgaggttacagaaatatggcaaaagattgccgccgaaactcgagcgata
gattttgaaaagttttacagtttcctgacagatgtgcagtgcgaggacatggatgcccag
ctggcacgggacctatttaatgagtattcgcacgaaggttacatggacgaagacctcctg
ttaaaatttctgactgcccaaccgtacgcaagggagatagaagaagactactcaaggccg
ctatcggaatatttcatttcgtcttcacacaatacatacttgcttggtaatcaggtaggt
agtatggctagtgtagagggctatattcaggcgctgcaacagggctgccgctctgtggag
attgatatatgggacagcgatgatggcccggtggtctgccatggaaagttgacctcatcg
ctaccgctccgcaacgtggttgacgtgatcaacaagtacgcgtttatcacatccccatac
ccgctaatattatcattagagattcactgccgatcggagggacagataatagtgaaacaa
cttttcgacgacattctggggccactcatctacgtggctgaccactctgtcggatggccc
agcctgcgagatctcaagcacaaaataataatcaaaagcaagaagctcagggtaaatgtg
gacatggctgcggatatataccactccacttcttccaagggctcatcttatgactcagag
tatgacgtgcagtcacagccctcatcaccaatgcccaggaggggcatgcgcgggatccac
atctcaaagcgcaaacaccgggtcattgagcagctgctgcagatttctgcaatccacggc
attaccttccgcaatttttcgttgccagagtccaagacgccaacacactgcttttccttg
agcgagcgcagcttcgataacctggccaacgatgacctgcagcgcctagcgatcgacaag
cacaaccggcgccacctgatgcgtgtatacccccatgcattccgctacaaatcgtcgaac
tacgacccgatcaaatgctggcgcctaggtgtccaaatggtagccaccaattggcagacc
tacgacctggggcagcagctaaaccaggccatgttccgcgttaccgcgcgcgacgactgg
ccatggccgtcgggctatgttcgcaagcccgagtatctcctccacaccgtcccaaaaacc
agctttatccgcgacatctacgaggccgtacacagctcggtcgtggcactatcgcttgag
ctgctttccgcccagctactgccgaagcccaagctttcctcgcgcgatggcgaggcccat
ttcgccccctacgtcgtcatagaggttctcggcgacggtctctgtgggccaatccacgtg
cagaacgggcttgtcaccgccccaaaccaagtaacttcctgccgctgtcccgaaaacggt
tttaatcctgtatggaagacgtccttgactgccactctcaacaatactggcttcaatttc
atcagatacattgtcaagaacgctgacattacgctagcgacctgctgcattcgcctcgac
tacatgaagagaggctacagacacataccgttatatagcctggagagctcgcgattcatc
ttctccacactctttgtaaaaaccgattacagaatcgtgagatctcttttctag

DBGET integrated database retrieval system