KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ACR056WHelp
Entry
AGOS_ACR056W      CDS       T00167                                 

Definition
ACR056Wp
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AGOS_ACR056W
   01230 Biosynthesis of amino acids
    AGOS_ACR056W
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AGOS_ACR056W
  Energy metabolism
   00680 Methane metabolism
    AGOS_ACR056W
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AGOS_ACR056W
Enzymes [BR:ago01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AGOS_ACR056W
Exosome [BR:ago04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AGOS_ACR056W
  Exosomal proteins of melanoma cells
   AGOS_ACR056W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:456517..457260
Genome map
AA seq 247 aa AA seqDB search
MPKLVLVRHGQSEWNEKNLFTGWVDVKLSAVGEQEAARAGELLKEHNVNPDILFTSKLTR
AIQTANIALTKADRIWIPVERSWRLNERHYGDLQGKDKAATLAAFGEEKFNTYRRSFDVP
PPPIADDSEFSQSNDERYRDVDPNVLPKTESLALVIDRLLPYWQDTISKELLSGKTVMIT
AHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPTKPSYYLDPEAAAAGAAA
VANQGKK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagttagtcctagttagacacggtcaatccgaatggaacgagaagaacctattc
accggctgggtggacgttaagttgtccgctgtcggcgagcaagaggctgccagagctggt
gagctattgaaggagcacaatgtcaacccagacattcttttcacctcgaagttgaccaga
gccatccagaccgccaacattgcgttgaccaaggccgacagaatatggatcccagtcgag
cgttcgtggagactaaacgagagacactacggtgacctacagggcaaggacaaggctgcc
accttggccgcattcggcgaggagaagttcaacacgtacagaagatccttcgacgttcct
cctccacctattgcggacgactctgagttctcgcagagcaacgatgagagatacagagac
gtggacccaaacgtcttgcctaagactgagtctttggccttggtcatcgacagactgttg
ccttactggcaggacaccatctccaaggagttgttgagcggcaagactgttatgatcact
gcccacggtaactcgttgagaggtttggtcaagcacctagagggcatctctgacgccgac
atcgccaagctaaacatccctaccggtatcccattggtgttcgagctggatgagaacttg
aagccaaccaagccatcctactacttggacccagaggccgctgccgccggtgctgctgcc
gttgccaaccaaggtaagaaatag

DBGET integrated database retrieval system