KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ACR061CHelp
Entry
AGOS_ACR061C      CDS       T00167                                 

Definition
ACR061Cp
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ago00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AGOS_ACR061C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:complement(466023..470975)
Genome map
AA seq 1650 aa AA seqDB search
MKWSVLPFEELYNSIQAEQFDLQLYNSLLPDLKELNLSDKYPRNDTSRKQLETGEITLSD
GDRYKINQQFIIAAVQLADELNLDELAVAELLLSSDEELDALDQDLLLLNQGKVRFYLRK
QFILQVVSYVVNVHSSESEVYRAIVEDGQLIDKILKGCKAVHQQLDDIKQSINKAQILDT
YDSLFQQNVNFKRDFLLKEYDILAQILYGVVKNSTKFDKDKIMSVIDHVSGMDSDDFFIM
YYMPALFLAWSKLSNFSESDVKALHYAFVKEINNEGIYTKPVKVTLIFVFLTYFIGWCKA
APTKRAKAFDFENTVDKPMTVAVEQGALEQLMVFAAETSTVEQDKSMELFYDMRSLLERH
IPRLLPKQLMDMEHRTAVVIKPVSQVPNKFSKITFSAQLESQFLYVFDDFIRASISDCAF
LLTKVKNAEEDSLLSGEDLYLDDISAKADLERFFLVVYYFYASRPSLSQFFWQDSESTFY
GFIEWAAKCNDNLMKSCFYLMMSSLSYGEENATNVYHYINGNQAISWHTIAQIISDYTVK
ISIVEKKMMELQPQSEEEKANFNNVALQEGLNEEVVILLSSLLTLIGSVAYDLPTEIQLS
LTEMFTEVLFEFIKVNTPLIGATMKVLGTLVPLTQEKREIFWTNLDKWIFKGSPLNSTDD
SYRMAFQSVLTNFSDVSGFLRLFSCMLAANTKNGSGKVAFGKLPYPIKLGAAYRKSGIWP
YFDFIFHEIFAHVTQLTDVPEKFSIVDPIFSIIQHSLSSFDYSVLLNSITAGVNLDSLIE
FGDFFTYVEESPATAAFNYLFEEKFFKIIFNIASAGVDELSGDLETTGQQLKMARAAIRI
LNMLLTYEGTYTEELCPIVKKHHKETHFIPKNFGLHGLSSYYDAILFDLPLIAHCGLYIG
IPDYILASESLDLLKKISLRFPYSDTRKNKVLTVFESVDESARIKEAFISQVSSFIDSEE
SLSLKLAILDFINMNLSYTNKTVTVAHFLLGFQVTNILSLGPTLSTFINSPSSLLNSLLD
ILLSSLASINPRNVDYAPIRLASILMEIIVKLCRNTLTSRLTLDFLSSKGLFERIIELDP
NIDNTSLWCDQSLHGSFNNINSSVLDGPAVGALLAFLRYRSHLLQYLSLDLHWLSTESQQ
SKISAAVAVLISSEIHAPTIFAFLDTLTYSKLPVAGDPPKDLTLFKNLDLSVNKIKLSSS
CTGNIYDFSSLDALLDLSFRTHALSVPAVDVQETSLQSIAKEETLKIKRFITTCLAHESY
SSLQLSVLHSWVQLVQIVVLDGSLTPVERSNFVLEVFEAIVPKINDYVEFDVAYSEELVS
LSVFLYDLYQKDRIQIDQEKTIDGRLHALFKTCIHGITSPLSTLCLRSDFYVLANKYLLR
IIKEESLAKEVLQSLKMASERLVEVICNDAISGEGSNKITGILLLDALAQIACLNKTNFI
LDVLMKSNMLLLIIRSIKATDELLSVSSHTITLDTLLYELTAFKSTVYFLIRLAKTRSGA
QALIQNEIFNTIESCSFLQIDPDLGLELIFDEISVKNSNFVRVNLNLDNPLTLGSQANGI
SLFEIVVPIFQLIVSILLSMGNANRPVMKSVKKLLVHFRKLVQGVLKRDALLESNEKYVV
DDSTMEGLEQQVKLVVLLCTLTGYLGEQDV
NT seq 4953 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggtccgtgctgccctttgaagagctctataactctattcaggcagagcagttt
gatcttcagctgtataacagtctgctacctgacttaaaagaactcaatctctcggacaaa
tatccgcggaatgacaccagcagaaaacagctagaaaccggagaaattaccctatctgac
ggtgaccgttataagatcaaccagcagtttataattgccgctgtgcagctggcagatgaa
ttgaatttggatgaattggccgtggctgaacttctgctctcgtcagacgaagaactggat
gcactagatcaggacctactactattgaaccaagggaaggtgcgcttttacctgcgcaag
cagttcatcttacaggtagtgtcctacgtggtgaatgttcacagctcggagagcgaggta
taccgcgctatagtggaagacggacagctcatcgacaagatactcaaaggctgcaaagcg
gtacaccagcaattagacgatatcaaacagtctatcaataaggcacaaattctggatacg
tacgattctctattccagcagaatgtgaacttcaagcgggactttctattgaaggagtac
gacattctggctcagattctatacggggtggtgaagaacagcactaagtttgacaaggac
aagattatgtctgtcattgatcatgtttccgggatggattccgatgacttttttatcatg
tactacatgccggccctctttctggcgtggtcaaaactctccaacttttcggaatccgac
gtgaaagcactgcactatgcatttgttaaagagattaataatgagggcatatatacgaaa
ccggtcaaggtgactttgatctttgtttttcttacctattttattggctggtgcaaagct
gcaccaaccaaaagagcaaaggcatttgatttcgaaaacacagtggacaagcctatgaca
gttgcggtggagcagggggctcttgagcagctaatggtgtttgcagccgagacctcaact
gtagaacaagacaaaagcatggaactgttttacgacatgcgctcgttattggagagacac
attcctcgactgttaccgaaacaattaatggacatggaacatcgaactgctgtagtcatt
aaacctgttagccaagttccaaacaagtttagtaagattacattctctgcccaactagaa
tcgcagtttctctatgtttttgacgacttcattcgagcatccatctcagactgcgcattt
ctattaaccaaggtaaagaatgccgaagaagattccctgttatctggtgaagatctttac
ttagatgacatttcagcaaaggcggatctcgaaaggtttttccttgtcgtctattacttt
tatgcttcgaggccctctttatcccagttcttttggcaggatagcgaatccacattctac
ggttttattgagtgggctgccaagtgcaacgacaacttgatgaagtcttgtttttatttg
atgatgtcaagtttgtcctatggggaggaaaatgctacgaatgtctaccattatatcaat
ggaaaccaagctatatcttggcacacaattgcacaaataattagtgactacactgtcaaa
atttctatcgttgaaaagaaaatgatggagcttcagccgcaatcagaagaggaaaaggcc
aactttaacaatgtcgcattacaagagggactcaatgaagaggtagttatattattatca
tcgctactgacactaatcggatcggtagcatatgatttaccaacggaaatccaactctct
ttaacagaaatgtttactgaagttctttttgaatttataaaggtgaatactccgctaatt
ggtgcaactatgaaggttctaggtacacttgttccattaactcaagaaaagagggaaata
ttctggactaatctagataaatggatttttaaaggttctccactgaactctactgatgat
tcatatcgtatggcattccagtctgttctcacaaatttctctgatgtatctgggtttcta
aggcttttctcttgcatgctagccgcgaataccaagaacggttctggtaaggtggcattt
gggaagttgccataccctattaaattaggcgctgcatacagaaagtcagggatatggcca
tatttcgatttcatttttcatgaaatatttgcccacgttacacaactcacagatgttcct
gagaaattttctatcgtggatcctattttcagtattattcagcatagtctctcttcattt
gactattctgttttgctgaactctatcactgcaggagtgaatttagattcattgatagag
tttggtgacttttttacgtatgttgaagaatccccagctaccgctgcgtttaactatctg
tttgaagagaagtttttcaaaatcatttttaatatagcttcagccggggtggatgagtta
tcgggggatttagaaacaactggacaacagctgaagatggcacgggcagccattcggata
ctcaatatgcttttaacttacgagggaacttatacggaagagctctgcccgattgtaaaa
aaacaccataaggagacacattttatcccaaaaaattttggtttgcacggattgagctca
tactatgatgcaatactttttgatctacctctgattgcccattgtgggctatacattggt
ataccagactatatccttgctagcgaatcacttgatttgctgaaaaagatatcattgcgc
ttcccttacagcgatacgaggaaaaacaaagttttgacagttttcgaatcagtggatgaa
tctgcaaggattaaggaagcgttcatttcccaagtttcttctttcatcgattcggaagaa
tcgctttccctgaagttggctattttagatttcattaacatgaatctctcatacactaac
aaaacagtgactgtagcccattttctcctcggtttccaagttaccaacattttgtcgctt
ggaccaactctttctacgttcatcaattccccctcctctctgctgaactcattactggac
atactattgtcatctctcgcatcgattaatccgcgtaatgtcgattacgccccaattcgg
ttggcctccatactgatggaaataattgtgaaactatgcagaaatactctcacttctcgg
ctgactctggatttcctttcttcgaagggattgtttgagaggattattgaactcgatccg
aatattgataatacgtctttatggtgtgatcaatcactccatggttcatttaataacatt
aactccagtgtcttggatggtccagcagtaggcgccttattggcctttttaagataccgc
agccacttattgcaatatctaagtttagatctgcactggctatctactgaatcacagcaa
tcaaagatatccgcagcagtcgccgtactaatatcaagtgaaatccatgcacctactata
tttgcatttttggacactttgacatacagtaagttacctgttgcaggggatcctccaaaa
gatctcaccctcttcaagaatttagatttgagtgtcaacaaaatcaagttatcgtccagt
tgtacgggtaacatctatgatttcagcagtttagacgcactgctggatctgagcttccga
acacatgctctttcagttcccgcggtggatgtccaagagacatctctacaaagcattgcg
aaagaagaaaccctcaagataaagaggttcattacgacatgcttggctcacgaaagctac
tcgtcacttcagctctctgttttgcattcgtgggtgcagttggtacagatagtggtactt
gacggctctcttaccccagttgagcgttctaactttgttttggaggtttttgaagcaatt
gtgccgaaaatcaatgactatgttgaattcgatgtggcttattcagaggaactggtctct
ctctctgtttttctatatgatctgtaccagaaagaccgcattcagattgatcaggaaaag
actatagatggaagactccatgcgctatttaaaacttgcatccatggtatcacttcgcca
ctatcaacactatgtctaagatccgatttttatgtgcttgcgaacaaatatcttcttaga
attataaaagaagaaagcttggcgaaagaagttttacaatcgctaaaaatggcaagtgaa
agacttgtagaggttatctgcaacgatgcgatttctggtgaggggtcaaataagattact
ggaattcttcttctcgatgcattggcccaaattgcctgcttaaacaagactaacttcata
ttagacgtcctcatgaagagcaacatgctgcttttgataattcgttccataaaggcgact
gatgagttgttaagcgttagctcccacacaataaccttggatactctgctatatgagctc
actgcattcaaatcaacagtttactttctaattagattggctaaaacaagaagcggtgcg
caggctcttattcaaaacgagatattcaatactattgagtcatgttcgtttttgcagatt
gatccagacctagggctagaattaatctttgatgagatttccgtcaaaaattcaaacttc
gttcgtgtcaatttgaatctcgacaacccattaaccctgggttctcaagcaaacggtatc
tcgttgtttgaaattgttgtgcctatcttccaattaatagtctcaatcttgttaagcatg
ggaaatgctaacaggccggtaatgaaaagtgtcaaaaaactcctagtccattttaggaag
ttggtgcagggagtgttgaagagagacgctttgcttgagagtaatgaaaaatatgttgtt
gatgattccaccatggagggcttagaacagcaagtgaagctagttgtcttattatgtaca
ctgaccggttatttgggcgagcaggatgtttga

DBGET integrated database retrieval system