KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ACR117WHelp
Entry
AGOS_ACR117W      CDS       T00167                                 

Definition
ACR117Wp
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:ago04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:557735..559309
Genome map
AA seq 524 aa AA seqDB search
MAFMFKPPEQRKRNEKSPRLSLPSTLIGSATPAGDEHASGAMGNSIGSDLHREQKLRGLG
QSVQIAEQLSAGSTDTAGSDVLSQHAPSSASSQTSKVLPRRPVPPGMPALAFLSKHPYAQ
QVTGPLPTTSGEKAGSHSGATTLSAGPTRPPLPKLPYLHVEPKLPCEELPYSALHAGSSS
SSNIHSPSRALQEMRLISAGSTPVEPVPPAATVPPCKDVDELEEEMWTHVHLKDQIEELG
VLGEGAGGSVTKCKLRHGSKIFALKTITTLTTDQESQKQIFRELQFNKSCKSDYIVRYYG
MFTDEEHSSIYIAMEYMGGRSLDAIYKHLLKHGGRVGEKVLGKIAESVLRGLSYLHQRKI
IHRDIKPQNILLNEAGQVKLCDFGVSGEAVNSLATTFTGTSYYMAPERIQGQPYSVTSDV
WSLGLTLLEVAQAHFPFDSGKFAANMPPIELLMLILTFTPQLKDEPEANIVWSKAFKSFI
SYCLKKESRERPSPRQMLRHPWIQGQMKKRVNMEKFIYKCWQAR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcatgttcaagccaccagagcagcggaagcgcaatgagaagtctccgagattg
tcgctgccgtcgacgttaattggtagtgctacccctgcgggcgacgaacacgcatcagga
gcgatgggcaactcaattgggtcggatctacacagggagcagaaactgcgtggacttggg
caatctgtacagatagcagaacagctatctgctggatctacggatactgcggggtcggac
gttctctcgcagcacgcgccatctagcgcatcgtcgcagacctcgaaggtccttccccgg
cggcctgtgccgccggggatgcctgcgctggcgtttctgtcgaagcacccgtacgcacag
caggtgacggggccgctgcccacgacgagcggagagaaggcgggaagtcactcaggtgca
accacgctgtccgcggggccaaccaggcctccgctgcccaagttgccgtacctgcacgtg
gagccgaagctgccctgcgaggagctgccgtactctgcgctgcacgcgggctcgagctca
tccagcaacatacattccccgtcgcgcgcattgcaggagatgcggttaatctctgctggc
agtactccggttgagccggtgcccccggcggcgactgtaccgccatgcaaagacgtggac
gaattggaggaagagatgtggacgcatgtgcacctgaaagaccagatagaagagcttggc
gtgctgggcgagggcgcgggcggatcagtcacgaagtgcaaacttaggcacggttccaaa
atcttcgcgctcaaaactataaccacgctgaccacggaccaggagagccagaagcagata
ttccgcgagctgcagttcaacaagagctgcaagtctgactacatcgtgcgctactacggc
atgtttaccgacgaggagcactcctcgatatacatcgccatggaatacatgggcgggagg
tcgctggacgccatctacaaacacctactaaaacacggcggcagggtcggcgagaaggtg
ctcggcaagatcgccgaaagcgtgctgcgcggcctgtcgtacctccaccagcgcaaaatc
atccaccgcgacatcaagccccaaaacattctcctcaacgaggcaggccaggtgaagctc
tgcgacttcggcgtgagcggcgaggctgtcaactcgctcgccactacgtttactggcacc
tcgtactacatggcgccggagcgcatccagggccagccttacagcgtcaccagcgacgtc
tggtcgctgggcctcaccctgctggaggtagcccaggcccacttccccttcgactccggc
aaattcgcagccaacatgccgcccatagaattgcttatgctgatcctcaccttcacgccg
cagctcaaagatgaacccgaggcgaacatcgtgtggagcaaggccttcaagtcattcatc
agctactgtctcaagaaggagtcgcgcgagcggccctcgcccaggcagatgctgcgccac
ccctggatacaggggcagatgaaaaagcgtgtcaatatggagaagttcatctacaagtgc
tggcaggccaggtga

DBGET integrated database retrieval system