KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ACR124WHelp
Entry
AGOS_ACR124W      CDS       T00167                                 

Definition
ACR124Wp
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AGOS_ACR124W
   00670 One carbon pool by folate
    AGOS_ACR124W
Enzymes [BR:ago01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AGOS_ACR124W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:568310..568945
Genome map
AA seq 211 aa AA seqDB search
MGISRVPVVSIVACLLPEYGIGYQGQLPWRLAREMKYFRQATTATFDPTKRNAVVMGRKT
WESIPARWRPLPGRLNVVVSRTYTSPWAHDENGHVITSNSLQQCVRQLQEQARALGVERI
YIMGGAEIYNQSYDLCDHLLVTELQVAPDGPAVLLDTFLARDVLEQSFAKNSAGPRALLP
PSVELPECPATALEEGGFQFRFALYDHLNRD
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcagcagagttcccgtggtcagcatcgtcgcatgcctgctccctgagtacggg
atcggctaccagggccagctaccgtggcgcctggcgcgtgagatgaagtacttccggcag
gcgaccaccgcgaccttcgaccctacaaaacgcaacgccgtggtgatgggcaggaagaca
tgggagtccatccccgcacgctggcggcccctgccggggcggctcaacgtggtcgtgtcg
cgcacatacacgtcgccgtgggcacacgacgagaacggtcacgtgatcacaagcaactcg
ctgcagcagtgcgtgcgccagctgcaggagcaggcccgcgcgctgggcgtcgagcgcatc
tacatcatgggcggcgctgagatctacaaccagtcctacgacctctgcgatcatctgctg
gtcaccgagctgcaggtagcaccggacggccccgccgtgcttctggacaccttcctcgcc
cgcgacgtgctggaacagtcgttcgccaaaaacagtgcggggccgcgcgccctgctgccc
ccgtctgtcgagttgccagagtgccccgcaacggccctcgaggagggagggtttcaattc
aggttcgcgctatacgaccatttaaatcgtgactag

DBGET integrated database retrieval system