KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ACR138WHelp
Entry
AGOS_ACR138W      CDS       T00167                                 

Definition
ACR138Wp
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:591528..592835
Genome map
AA seq 435 aa AA seqDB search
MAQEEEKDAGISKYISTTDEIIIGCKCWVEKDGEQRLAEILSINNRRQPPKFYVHYEDFN
KRLDEWILASRINIEREVTFPKPRDPDEKKKKKQKKSATPQATDGETLESADIMDLENLN
VQGLRDEGISRDDEIKKLRTSGSMTQNPHEVSRVRNLSKIIMGKHEIEPWYFSPYPIELT
DEDVVYIDDFSLQYFGSKKQYARYRQKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRN
LCLLSKLFLDHKTLYYDVDPFLFYCMTQRDELGHHLVGYFSKEKESADGYNVACILTLPQ
YQRMGYGRLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLIKLLVENGTEITI
DEISSMTSLTTTDILHTAKALNILRYYKGQHILYLNEDVLLRYEKLIAKKRRSIDPEKLI
WKPPIFTASQLRFAW
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagaagaggagaaagatgccggcatttccaagtatatctcgactacggatgaa
atcatcatcggatgtaaatgttgggtcgaaaaggatggtgagcaaaggctggctgaaatt
ctgtcgataaacaaccgaagacagcctcccaagttctacgtacactacgaggatttcaat
aaacgtctagatgagtggatactggcatccaggataaatatcgagcgagaggtaacgttt
ccgaagcccagggaccccgatgagaagaagaagaagaagcagaagaagagcgcaacgccg
caggccaccgacggggagaccctggagtctgccgatatcatggacctcgagaacctcaat
gtgcagggcctgcgggacgaaggcataagcagggacgacgaaatcaaaaagctgcggaca
tctgggtcgatgacgcagaacccccacgaggtttcgcgtgttcggaatctcagcaagata
attatggggaaacacgaaatagagccctggtacttctctccgtacccgatcgagctgacg
gatgaggacgtggtgtacatagacgatttctccctgcagtacttcggttccaagaaacag
tacgctaggtaccgccagaaatgtactctgcggcacccgccgggcaacgaaatatacagg
gacgattacgtctcctttttcgaaatcgacgggcgcaagcagcgaacgtggtgccgcaac
ctatgccttctgtcaaagctgtttctggatcacaagacgttgtactacgacgtcgaccct
tttctcttttactgcatgacacagagagatgagcttgggcaccacctggtgggatatttc
tccaaagaaaaagagtctgcggacgggtacaatgtggcgtgtattctgacgctccctcag
taccagcggatggggtacggcaggctgctgattgagttttcgtatgagctctctaagaag
gagaacaaggttgggtcgccggagaagccgctctctgatcttgggctgctctcctacaga
gcctattggtccgataccctgatcaagctgctagtcgaaaacggcaccgagatcacgatc
gatgaaatcagtagcatgacatcgctcacgactacagacatactgcacacagccaaggct
cttaacatactgcgatattacaagggccagcacatcttgtacctgaacgaggacgtgctg
ctaaggtacgagaagctgatagcgaagaaaaggcgatcgatcgaccccgagaagctgatc
tggaaaccgccaatctttactgcgtcccagctaaggttcgcatggtag

DBGET integrated database retrieval system