KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ACR196CHelp
Entry
AGOS_ACR196C      CDS       T00167                                 

Definition
ACR196Cp
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ago00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    AGOS_ACR196C
Enzymes [BR:ago01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     AGOS_ACR196C
Protein kinases [BR:ago01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   AGOS_ACR196C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:complement(692326..693918)
Genome map
AA seq 530 aa AA seqDB search
MSQHIFQTKSLKRKNLKKLTLEAGGSEELEGAARGDILRATEDRLSGAPTLLKAGARPMR
SPEPVWGLGSVPGPASVQGVLDMASSQRAAEPATQRPGLFHNGTPDNQLRGGKPCMTLRM
KRMQKPLNLNIEPEGVKSKVVIAQPSPTNSDSSTSVSPIVPSKITSNKRDNRLSTKFSRL
SIFQDDNNDIQLEDLVQLGKIGAGNSGTVVKTLHVPDSRIIAKKSIPVENSELVKNQLMR
ELTIMKNVKEQKNIVGFYGAYYTAIKNHEIIILMEYMDCGSLDKISSTYRRYCSRNKVPM
NASTSWFTELSLSKISYAVLNGLSYLYQDYKIIHRDIKPSNILINSKGFVKICDFGVSKK
MIDSIADTFVGTSTYMSPERIQGSCYNTKGDVWSLGLMIIELVTGEFPLGGHNDTPEGIL
DLLQRIVNEEPPSLPASGDFSADIMDFVNCCCVKDERKRSSLQELMTHRYITKYNDSDDY
QRTFRHWCKKIKKRIKADKMIQREEMERARLVNRQLERSAQAAMAARSGR
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacacatctttcaaaccaagagcctgaaacgtaagaacctcaagaaattgacg
ctcgaggccggaggcagtgaggagctggagggcgcagcaaggggtgacatactgcgcgcg
acggaggacaggctttcgggggcgccgacgctgctcaaggccggggccaggcccatgcgg
agcccagagccggtctggggcctggggagcgtaccgggtcctgcatcagtacagggtgtc
ctggacatggctagtagccagcgcgctgcggaaccggccacccagcggccgggtctgttt
cacaacggaacgccggacaaccagctacgcggggggaagccgtgcatgacgctgcgcatg
aagcgcatgcagaagcccctcaacttgaacattgaaccagagggcgtgaagtcgaaagtt
gtcatcgcgcagcccagtccaacaaactcggactcatcgactagcgtaagccccattgtg
cccagcaagatcacgagcaataaacgcgacaaccgattgtcgaccaagttctcccggcta
tctatattccaggatgataacaacgacatccagctggaagatctcgtgcagctaggcaag
attggggccggcaattctgggactgtggttaagaccctccacgtgccagactctcgaatc
atcgccaagaaatccatccctgttgaaaacagcgagctcgtcaaaaaccaattgatgcgt
gagctcacgatcatgaagaatgtgaaggagcagaagaacatagttggtttctatggtgcc
tactacaccgcgataaaaaaccacgaaatcatcatcttgatggagtacatggactgtggc
tcgttggacaagatctccagtacctacaggcggtactgcagcagaaacaaggttcctatg
aacgcttctacctcgtggttcaccgaactgtcactctccaagatctcttacgcagttcta
aacgggctatcatatttatatcaggactacaagatcatccaccgtgatatcaagccatcg
aacatccttataaactccaaaggctttgtcaaaatatgcgacttcggtgtctcaaagaaa
atgatcgattccattgctgacaccttcgtgggcacctccacatatatgtcgccagaacgc
atacagggtagttgttataataccaagggggacgtctggtccctaggattaatgattata
gaactagtgacaggcgagttcccacttggcggccacaacgatactcccgaaggcatttta
gatctactgcagaggatagtcaacgaagagccgccctcgcttccggcaagcggcgacttt
tcggcggatattatggacttcgttaactgctgttgtgtgaaggacgagcgtaagcgctct
tccctgcaggagcttatgactcaccgctacataaccaagtacaacgacagcgacgattat
caaaggacattcagacattggtgtaaaaagattaaaaagcgcatcaaagcggataagatg
atccagcgcgaggaaatggagcgcgcaaggctcgtcaacaggcagctcgagcgctccgcc
caggctgccatggccgctaggagcggcaggtag

DBGET integrated database retrieval system