KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ACR229WHelp
Entry
AGOS_ACR229W      CDS       T00167                                 

Definition
ACR229Wp
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ago00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AGOS_ACR229W
Translation factors [BR:ago03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    AGOS_ACR229W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:762384..763190
Genome map
AA seq 268 aa AA seqDB search
MSWDDEEFEVRTSTKDQPMVVSWDDEFNNDDDDALLESWDAEEVPKQKQKPKAAPKAAKK
VDKKGETVLLEIDTLDEKTRKELLKKAELNSDLNNAAALFDGLGVAEEHPRARALRQEEE
LAALSRPAALTKQTPFESHPLFSEAETKSDFQDLRKALSTAIAGMAEKSSLNYSGALAID
LIRDVAKPLSIESIRQTVATLNVLIKEKERQERQARLAKVKGGTATGGAGKKKAKAARPN
LGGAFKKDQEFSLEDNSEFADFGDDDFM
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggacgacgaggagtttgaggtgagaacttcgacgaaggaccaaccgatggtt
gtgtcctgggatgacgagttcaacaacgacgatgacgatgcgctattagagtcatgggat
gcagaggaggtcccaaagcaaaagcaaaagcccaaggcagcacccaaggcagctaagaag
gtcgacaagaagggcgaaaccgtgctgctggagatcgacactctcgatgagaagacgcgc
aaggagcttttgaagaaggccgagctcaactcggacctgaacaacgctgcagcgctattt
gatgggcttggtgttgcagaagaacatccgcgtgcccgcgcgctgcgccaggaggaggaa
ctagctgcgctgagccgtcccgctgccttaacgaagcagactcctttcgagagccaccct
ctcttctcagaagcggaaaccaagtccgacttccaggatttgcggaaggcattgtctact
gcgattgcaggcatggctgagaagtcatcactaaactattcgggcgcgcttgccatcgat
ttgatccgtgacgtcgcgaaaccattgtcgattgaatccatcagacaaacggtcgcgacc
ctgaacgtgctgatcaaagaaaaggagagacaagaaagacaggcacgtcttgccaaagtt
aagggcggcactgccaccggtggtgcaggcaaaaagaaggcaaaggctgcaagacctaac
ttgggcggtgcattcaaaaaagaccaggagttttccttggaagacaactctgaatttgca
gactttggcgatgatgacttcatgtaa

DBGET integrated database retrieval system