KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ACR268CHelp
Entry
AGOS_ACR268C      CDS       T00167                                 

Definition
(RefSeq) ACR268Cp
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00620  Pyruvate metabolism
ago00630  Glyoxylate and dicarboxylate metabolism
ago01100  Metabolic pathways
ago01110  Biosynthesis of secondary metabolites
ago01200  Carbon metabolism
Module
ago_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AGOS_ACR268C
   00630 Glyoxylate and dicarboxylate metabolism
    AGOS_ACR268C
Enzymes [BR:ago01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AGOS_ACR268C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 4619805
NCBI-ProteinID: NP_983670
UniProt: Q75BK3
Position
III:complement(843117..844775)
Genome map
AA seq 552 aa AA seqDB search
MVAVSLERVQVLGQIDAEPRFKPSTTTVADIVTKEALEFVVLLHRTFNGRRKDLLARRQE
LQQRLDSGEATLDFLPETRAIREDPTWQGPPLAPGLVNRSTEITGPPLRNMLINALNADV
NTYMTDFEDSLAPTWENITYGQVNLYDLIRSRADFAVGSKQYQLRDRFERLATLLVRPRG
WHMVDKHVLVDDEPISASILDFGLYFFHNAAKLVEVGKGPYFYLPKMEHHLEAKLWNDIF
NVAQDYIGMRRGTVRATVLIETLPASFQMDEIIWQLRQHSAGLNCGRWDYIFSTIKKLRG
QSQHVLPDRDQVTMTSPFMDAYVKSLIRTCHRRGVHAMGGMAAQIPIKDDPAANEAALAK
VRADKIRELQNGHDGSWVAHPALVPICNEVFRNMGTPNQIHVVPEVHIGARDLVNTSISG
GRVTIAGIRQNLDIGLQYMEAWLRGSGCVPINNLMEDAATAEVSRCQLHQWVRHRVKLAD
TGENVTPDLVRGLLRERTDALARASRAGSSNKFALAAKYLEPEITAERFTDFLTTLLYDE
IVTPTNASKSRL
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggtagcagtcagcttagaaagagtgcaggtgctcgggcagatcgacgcggagccacgg
ttcaagccgtcgacgacgacagtggcggacatcgtgacgaaggaggcgctggagtttgtg
gtgctgctgcaccgcacgtttaacgggcggcggaaggacctgcttgcgcggcggcaggag
ctgcagcagcggttggacagcggggaggcgacgctggacttcctgccggagacgcgggcg
atccgcgaggacccgacgtggcaggggccgccgctggcgccgggcttggtgaaccgttcg
acggagatcacgggcccgccgctgcggaacatgctgatcaacgcgctgaacgcggacgtg
aacacctacatgacggacttcgaggactcgctggcgccgacgtgggagaacatcacgtac
gggcaggtcaacctgtacgacttgatccgcagccgcgcggactttgcggtgggcagcaag
cagtaccagctgcgcgaccggtttgagcggctggcgacgctgctggtgcggccgcgcggg
tggcacatggtagacaagcacgtgcttgtcgacgacgagcccatcagcgcctcgatcctg
gacttcggactttacttcttccacaacgcggctaagctagtggaggtgggcaagggccca
tacttctacctgcccaagatggagcaccacctggaggccaagctgtggaacgacattttc
aacgtggcgcaggactacatcggcatgcgccgcggcaccgtgcgtgcgaccgtgctgatc
gagactctgcctgcctcgttccagatggacgagatcatctggcagctgcgccaacactcc
gcaggcctcaattgcgggcgctgggactacatcttcagcaccatcaagaagctgcgcggg
cagtcgcagcacgtgctgcctgaccgtgaccaggtcacgatgacctcaccgttcatggac
gcctacgtcaagagcctgatccgcacgtgccaccgccgcggcgtacacgccatgggcggt
atggccgcgcagatccccattaaggacgaccccgccgcgaacgaggccgcgctcgccaag
gtccgcgcagacaagatccgcgagctgcagaacggccatgacggctcctgggtcgcacac
cccgcgctcgtgcccatctgcaacgaggtcttccgcaacatgggcacgccgaaccaaatc
cacgttgtgcccgaggtccacatcggcgcgcgcgacctcgtcaacacctccatctccggc
ggccgcgtcacgatcgcgggtatccgccagaacctggacatcggcctgcagtacatggag
gcctggctgcgcggaagcggctgtgtccccatcaacaatctgatggaggacgccgccacc
gcagaggtctcgcgctgccagcttcaccagtgggtccgccaccgcgtcaagctcgcggac
actggcgagaacgtcaccccggacctcgtccgcggcctcttgcgcgagcgcaccgacgcc
ctggctcgtgccagtcgcgccggctcatcgaacaagtttgcgctggccgctaagtacctc
gagccggagattaccgccgagcgcttcacggacttcctcaccaccttgttgtacgacgag
atcgtgacccccacaaacgcctcaaagtcgcgtctctga

DBGET integrated database retrieval system