KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADL008WHelp
Entry
AGOS_ADL008W      CDS       T00167                                 

Definition
ADL008Wp
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ago04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV:694966..697053
Genome map
AA seq 695 aa AA seqDB search
MWVTLRVCIYVSLFAGRVFSASVGTPATEPAGEQEKMPEPLTSVDFSSTMSTGLHMVEFY
SPLCHHCKLFAPTWEKTWKEFHKKGARMGISMAQVECLQSGDLCKQENVVSYPSIRLYGP
AGYIKDYPHMERDQESLVQFMMAEARNKNNMELMGLESKSEPLNKKRFNQLLEAGVESPT
LISFWPAPEVADITKVTQFRNCRYCAAFRNTWKLLSNRADTEGISTFHFSCYLNGDLCRK
VGLERLTKRSGDGEKIPALALLLPNVDSLIFYERDSYAFEDFLDFVLRSYSNYLAPHISP
EEVAKMLLTVPKVSDISEGFAGKTILLYNPAPTTNAEKDGKLLHSLLRELDGIPNVYIYK
FEGRLKKNIDRMLDRIYTTLLERASQELVGLNKELFHLRTLSVGDPLFIMFKECSRTPIA
LQNQVDQEDISSRAIQWIKENSYPYLRDFTRTSGKPLLKGKDSPRKPVVIQVLDTSNEQE
VKSSKNIKGFFDVISKFEGTWDEYVYKGLSRLYGDKAILKIVNGNDKTETAFLSEINEKL
TENYNGVLYGYIDKSSKKALKRLGLNVHDYELENGDVLIVDEKGKFYYAKGLDGSRMTVH
SPEHVVDAIRALVFPESGKSRNDLRRFLVGSPFGPRWRFFEHIHQYGFLGWFLLIVAVFF
ALRLPRIYKKYVQRKKYAARHDTMGILGKEGAFPE
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtgactctcagggtatgtatctacgtctccctgtttgctggtcgggtgttctca
gcgagcgtgggcacccccgcaaccgagccagctggtgagcaggagaagatgccggaaccg
ttgacttccgtggacttcagtagcaccatgtccacggggctgcacatggtggagttctac
agtccgttatgccatcactgcaagctatttgcacccacatgggagaagacatggaaagag
ttccataagaagggcgctcggatgggcatttcgatggcacaggtggaatgcctgcaaagt
ggggacctgtgcaagcaggagaacgtcgtctcatatcccagtattcgcctatatgggcca
gcgggctatatcaaggactatccccacatggaacgcgaccaagagagcttggtacagttt
atgatggcagaggcgcgtaacaagaacaacatggaattgatggggctggagagcaagagc
gagccgctgaacaagaagcggttcaaccagcttttggaagctggtgtggaaagccctacg
ctcatctcgttctggccggcacctgaggttgccgatatcacgaaggttacccagttccgc
aactgcaggtattgcgcggctttccgaaatacgtggaaactgctttccaaccgtgcagac
actgaggggatcagcactttccatttttcatgttatctgaatggggacttatgccgaaaa
gttggcctagagcggttaactaagcgctcaggtgatggtgagaaaatacccgcattggcg
ctactgctaccgaatgtggattcactaatcttctacgaacgagacagctatgcatttgag
gacttcctagattttgtcttaagatcgtactctaactatttggcccctcacatttctcca
gaagaggttgccaaaatgcttctaacagtcccaaaggtttcagatatatccgagggcttt
gctgggaagacaatacttctgtataaccctgcgcccaccacaaacgctgagaaggatggt
aaacttttgcacagtttattgagggaattggacgggattccaaacgtttacatatacaag
tttgaagggagattaaagaagaatatagaccgcatgctggaccgcatatatacgacgctt
ctcgaaagagcgtcgcaagagttagttggcctaaacaaggaattgtttcatctgaggacg
ctgtccgtgggagatcctctattcattatgtttaaggaatgctctagaacgcctatagca
ttacaaaaccaggttgatcaagaggatatttcttctcgagcaatacagtggataaaagag
aattcatatccatatctacgtgatttcacccgtacttctggtaaacccttactgaaaggg
aaggactcgcctcggaaaccagttgtcattcaggttttggatactagcaatgagcaggaa
gtaaaaagttccaagaacataaaagggttttttgatgttatatccaagtttgaaggaacc
tgggatgaatatgtttacaaaggacttagccgcctgtatggcgacaaggcaatattgaag
attgtaaacgggaacgacaagacggaaaccgcctttttgtcggagatcaatgaaaaactc
acagaaaactataatggggtgctatatggctatattgacaaatcaagtaaaaaagcactg
aagagactgggtctcaacgttcacgattatgaattagaaaacggcgacgtgctgattgtg
gacgagaaggggaagttctattatgcaaaagggctcgacggaagccgtatgacggtccac
tcacccgagcatgtggtcgacgcaataagggcgctggttttccctgagtcaggcaagtcc
aggaatgatctgcggagattcctagtcggctcaccgtttggccccaggtggcgatttttt
gaacacatccaccaatatggctttctgggctggttccttctcattgtagcggtgttcttc
gccctacggctgccgcgcatctacaaaaagtacgttcaacgcaaaaagtacgctgccaga
catgacaccatgggaatcctgggcaaggagggagccttccctgaatag

DBGET integrated database retrieval system