KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADL043CHelp
Entry
AGOS_ADL043C      CDS       T00167                                 

Definition
ADL043Cp
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
Enzymes [BR:ago01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AGOS_ADL043C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV:complement(612500..614521)
Genome map
AA seq 673 aa AA seqDB search
MAENTQLRRKRTRAFDLNGSRAVGAQNGRMGAAGVEMGDATGTARNGLYIEEEPDPLVND
MLQRQMFLLGSNSGNSGDSGSLVRDADDADSSLAFMGDVGDMVGELALGGTHAGSNYTAR
RFKKQRTVSLPQLPHAKLFYRLDARGPAASKAVPRRSQNDDELLHISGSSSRTLDGNRMV
TLPVIRSESPSSLLPPTQLEQQTALNGSAITKATSLLTGQQKLPKLITRRQRSIRRDNFN
TDKEGHYVFHGNDIFANGRFMTEELLGQGTFGKVVKCVDNAEPTKKHVAVKIIRALDRYR
QAAKTELRVLQTIRDNDPLGQFQCLLLRDCFDYRNHICLVTDLFGKSIYDFMCNNGNPRF
PGSHVQAISRQLIRSVCFLHDLGIIHTDLKPENILICDESFVETPLPDTVLATLSTRRKQ
VSGGKHKVLTNPEVKLIDFGSAVFCEEYHPPVISTRHYRAPEIVLGLGWSFPCDLWSIGC
VLVELVTGESLYPIHENLEHMAMMQRVNGQSFPRKMISKMFYKVEHKLGNLPTDLMTTVV
RHFDKTSMALQWPERNYKGEIVTKEKSMKRVMATCDRLDKHISTKLQRDYGEWLIIDWDY
TPEQNWSMIESKFYNRTMRIDRETFLFWYWFVDLCRKMFEFDPTKRITAKDAMDHEWFTY
GILDEGISSFGQT
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaatacacagctccggaggaagcgtacacgggcgtttgacctaaatggctcg
cgcgccgtcggcgcgcagaacggacgaatgggcgctgcgggggtagagatgggggacgcg
actgggactgcgcgcaatgggctttacattgaggaggagccggatccgcttgtcaatgat
atgctgcagagacagatgtttctgctcggaagcaactctgggaactcgggagatagcggc
agcctggtgcgagacgcagatgatgcagactcgtcgctcgcgttcatgggggatgtgggc
gatatggtaggggagctggctctcggtggtacgcatgccgggagcaactacactgcgcgt
cgcttcaagaagcagcgtacagtgtcattaccacagctgccacacgctaaattattttac
cggctagatgcacgcggacctgctgccagcaaagctgtgccgcggcgcagccagaatgac
gacgagctacttcatattagcggatccagcagcaggactctggatggaaatcgcatggtg
acgttgcccgtgattcgctcagagtcgcctagttctttactacctcccacacagcttgag
cagcaaaccgcgttaaatggcagtgccattactaaagcgacatctctcttaacggggcag
cagaaacttccaaaacttattacacggcggcaaaggtctataagacgggacaacttcaat
acggacaaggagggtcactatgttttccacggtaatgatattttcgctaatggacgattt
atgacggaggaactacttggccagggaacttttggaaaagttgtaaaatgcgtggacaac
gcagaacccactaagaaacatgttgcagtaaagataattagagccttagacagatatcgg
caggccgctaagacagaactccgtgtgctgcagaccatccgtgacaatgatccactggga
caatttcagtgtttgttactacgtgattgctttgattacagaaaccacatatgtctcgtg
actgatctctttggtaaatcaatatatgacttcatgtgcaacaacggcaatccaagattt
cccgggtcccatgttcaagctatctctcggcagctgattaggtcagtctgctttttacat
gacctgggtataatacatactgacctgaaacccgagaacatattgatatgtgatgaatct
tttgttgaaacaccattaccagacactgtgctagctaccttgagtacccgcagaaaacaa
gtatccggtggtaagcacaaagttcttacaaacccagaagtgaagctcattgatttcgga
tctgctgtattttgtgaagaatatcacccaccagttatttcaacacgtcattatagggcc
ccagaaattgtattgggtttaggttggtcttttccttgtgatttgtggtctattggatgt
gtactagttgagctcgttaccggtgagtccctttatccaattcatgagaacttggaacat
atggcaatgatgcaacgggtgaatgggcaatcttttcctaggaaaatgatcagcaaaatg
ttctataaagtagagcacaaactagggaatttgccgacggatttgatgaccactgtggta
aggcattttgataagacatctatggcattacaatggccggaacggaactataaaggagaa
attgtaacaaaggaaaaatccatgaaacgcgtgatggcaacatgcgacaggctagataag
catatatctacaaaactacaaagagattatggtgaatggctcataatagattgggattat
acccccgaacagaattggagcatgattgaatccaagttttataatagaacaatgaggata
gatcgcgaaacctttctattctggtactggtttgtagatctatgccgaaagatgtttgag
tttgatccgaccaaaagaattaccgcaaaagatgcgatggatcatgaatggtttacctac
gggattttagatgagggaatatccagttttgggcaaacctaa

DBGET integrated database retrieval system