KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADL066CHelp
Entry
AGOS_ADL066C      CDS       T00167                                 

Definition
(RefSeq) ADL066Cp
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00630  Glyoxylate and dicarboxylate metabolism
ago01100  Metabolic pathways
ago01110  Biosynthesis of secondary metabolites
ago01200  Carbon metabolism
Module
ago_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AGOS_ADL066C
Enzymes [BR:ago01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     AGOS_ADL066C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 4620172
NCBI-ProteinID: NP_984030
UniProt: O94198
Position
IV:complement(564208..565890)
Genome map
AA seq 560 aa AA seqDB search
MSPSVRDARNDLASLQQQAAAEAEDIRRWWSQPRWAGTKRVYTAEDIVKRRGTFPVVEYP
SSVMADKLVETLARHSRNGTVSQTFGVLDPVQMTQMVKYLDTIYVSGWQCSATASTSNEP
GPDLADYPMDTVPNKVEHLFMAQLFHDRKQREARLSCTTQRELDQLGPEIDYLRPIVADA
DTGHGGLTAVFKLTKMFIERGAAGIHMEDQSSSNKKCGHMAGRCVIPVQEHISRLVTVRM
CADVMHSNLVLVARTDSEAATLLSSNIDARDHYYIVGASNPEVTVPLIEVLDAAQQAGAS
GDRLAQLEEDWCKKAKLRLFHEAFADQVNASPSIKDKAGVIAKFNSQIGPQTGASIREMR
KLGRELLGQDVYFDWDLPRAREGLYRYKGGTQCAIMRARAFAPYADLVWFESNFPDFQQA
KEFAQGVREKFPNKWMAYNLSPSFNWPKAMPPKEQENYIQRLGEIGYVWQFITLAGLHTN
ALAIDNFSREFSRFGMRAYAQGIQQREMDEGVDVLKHQKWAGAEYVDSILKLAQGGVSST
ASMGKGVTEEQFGSSNGAKL
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtccccttccgtcagagacgcccgcaacgaccttgccagcctgcaacagcaggcagcc
gccgaagccgaggatattaggagatggtggagccagccacggtgggcgggcaccaagcgc
gtgtacacggccgaggacatcgtcaagcgccgcggcacgttccctgtcgtcgaataccca
tcttccgtaatggcggacaagctcgtggagacattggcgcggcactcgcgcaacggcacg
gtttcacagacgttcggagtgctcgacccagtgcaaatgacgcaaatggtgaagtatctg
gacacgatttacgtgtctggctggcaatgcagcgccacggcttcgacctcgaacgagcct
gggcccgatctcgcggactatccgatggacaccgtgccaaacaaggtcgagcacctgttc
atggcgcagctgttccacgaccggaaacagcgcgaggcccgcctgtcgtgcactacccag
cgcgagctcgaccaattggggcctgagattgactacttgaggccgattgtcgctgacgca
gacaccggccacggcgggctaacagccgtctttaaactcacgaagatgttcatcgagcgc
ggtgcagccggtatccacatggaggaccagtcctccagcaacaaaaagtgcgggcacatg
gcgggccgctgcgtgatccctgttcaggagcacattagtcgtttagtgactgtgcgcatg
tgtgcggacgtgatgcactcgaacctggtgcttgtcgcgagaacagactcggaggccgcc
accttacttagctcgaacattgacgcgcgcgatcattactacattgtcggggcctcgaac
cctgaggtaactgtaccgctgatcgaagttttggacgccgcgcagcaggccggcgcctca
ggtgacagattggctcagctagaggaggactggtgcaagaaggccaagttgaggctcttc
cacgaggcatttgccgaccaggtgaatgccagcccttcgatcaaagacaaggcgggcgtt
attgccaaatttaactcacagatcgggccacagacaggcgcgtcgatcagagagatgcgc
aaactgggccgcgagctgctcgggcaggacgtctacttcgactgggacctgcctcgcgct
agagagggcttgtaccgctacaagggcggcacccagtgcgcgatcatgcgcgcacgcgcg
ttcgcgccgtacgccgacctggtctggttcgaatccaacttccctgacttccagcaggct
aaggagtttgcgcagggcgtgcgcgagaagttccccaacaagtggatggcctacaacttg
tcgcccagcttcaactggccgaaggccatgcctcccaaggagcaggagaactacatccaa
cggctgggcgagatcggatatgtgtggcagttcatcacgctagccggcctgcataccaat
gccttggccatcgacaacttctcgcgcgaattcagcaggttcggaatgcgtgcgtatgca
caaggcatccagcagagggagatggacgagggcgtcgatgtcctaaaacaccagaagtgg
gccggcgcagagtatgttgacagcattctcaagcttgcccagggcggtgtgtcttcgaca
gcctcgatgggtaagggtgtaaccgaagagcagttcggctcctcaaacggtgccaaacta
tga

DBGET integrated database retrieval system