KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADL073WHelp
Entry
AGOS_ADL073W      CDS       T00167                                 

Definition
ADL073Wp
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
Enzymes [BR:ago01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     AGOS_ADL073W
    1.3.1.94  polyprenol reductase
     AGOS_ADL073W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV:554128..554961
Genome map
AA seq 277 aa AA seqDB search
MQRNPRYNSQHMNQMLPPIAAGGAEVYVWHLIHFSYGIGLFSLWLAKYRLPKLLQYGKTR
QKKLVGVIEPWYTSIAVPRRYFSHFYVLSFVLATANLYWFPEDVITSCIFFHSLRRLVES
ARVTKWGSESRMHAAHYLVGLWFYSVLNLSVYLQLNSRQRTRSPSTVNKVFGAVGAVGFL
LASWDQARNHIHLAHMIKYTLPRRGLFKIVACAHYFDEIVIYASLAAMEATTRWSLTVAV
IWVCANLGVSAVETKRYYDAKFKGQAVAPYALIPYIM
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgtaatccaaggtacaattcacaacacatgaaccaaatgttgccaccaatagcc
gctggcggagcagaagtttatgtgtggcacctaatccactttagttatggtattgggctt
ttctctttgtggctggccaagtaccgactcccgaaacttctgcaatatggtaaaactagg
cagaaaaagctggtgggcgtgattgaaccatggtacacatccatcgcggtaccgcgtcga
tacttttcacatttctatgtcctttcgtttgtcctcgcgaccgccaatctatattggttc
ccagaggatgtgatcacaagctgcatattcttccattctctacgcaggcttgtggagtcg
gcgcgggtcaccaagtggggctcagaatctcgaatgcatgctgcccactaccttgtcgga
ctatggttctactctgtgctcaacttgagtgtgtacttgcagctcaattccagacagagg
acccgatcccccagcacagtcaacaaggtatttggcgcggtgggcgcagtgggatttctc
ctcgcctcatgggaccaggcaaggaaccatatacacttggcgcacatgattaaatatacg
ctaccccggcgtggactgttcaaaatcgtggcgtgcgcgcattatttcgatgagatcgtt
atctatgcgtcactagccgcaatggaggcgacgactaggtggtcactcactgtggcggta
atctgggtgtgtgcaaacctgggtgtcagtgcggttgaaacgaagaggtactatgacgct
aaattcaagggtcaagccgtggccccctatgcgctcattccgtacattatgtaa

DBGET integrated database retrieval system