KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADL176WHelp
Entry
AGOS_ADL176W      CDS       T00167                                 

Definition
(RefSeq) ADL176Wp
  KO
K10739  
replication factor A2
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ago00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AGOS_ADL176W
   03420 Nucleotide excision repair
    AGOS_ADL176W
   03430 Mismatch repair
    AGOS_ADL176W
   03440 Homologous recombination
    AGOS_ADL176W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV:join(386736..386742,386801..387621)
Genome map
AA seq 275 aa AA seqDB search
MATYQQPFNEFSTVTGGGFDSQASAGRPGSTGGQSTATLTPVTIKQILEAKQQVQDGPYV
VHSMELHNICFVGVVRNVVDNTANVNVTVEDGTGQIEFRQWSNDQKDMERASQGETAEYN
SELSQQFQIGNYVKVFATLREFGGKMNIQYALVKPVENFNEVLAHHLAAIKCYALANGRL
APPAAPFNAAAGAQGGQSLFVQDNDYSSAKPATQRILDFCRDQCKDKDANTFSVHTKFIA
QSLSMLEDDVRMHCQTLTEQGFIYPTFDENSYFTL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggccacataccagcaacctttcaacgagttctctacggtaaccggaggagggtttgat
tcgcaggcgtcagccgggcggcccgggtccacaggcggccagtcaaccgcgactctgacc
ccggtgacaatcaaacagatactagaagccaagcaacaggtgcaggatggcccatacgtg
gtgcacagcatggagctgcacaatatatgctttgtgggcgtggtgcgtaatgtggtggac
aacaccgccaatgtcaacgtgacagtggaggacggcacagggcagatagagtttcggcag
tggagcaacgaccagaaggacatggagcgcgcgagccagggcgagacggccgagtacaat
tcggaattgtcgcagcagttccagatcggcaactatgtcaaggtttttgccacattgcgc
gagttcggagggaagatgaacatccagtacgcgctggtcaagcctgtcgagaacttcaat
gaggtgctggcacaccacctcgccgccatcaagtgctacgcgctcgcaaacggccgcctg
gcgccgcctgctgctccgtttaacgccgcggccggcgcccagggcggccagagtctcttt
gtgcaggacaacgactacagcagcgccaagcctgctactcagagaatcctggacttctgc
cgcgaccaatgcaaagacaaggatgcaaacaccttctctgtgcacacaaagttcattgcc
cagtcgctgagcatgctggaggacgacgtccgcatgcactgtcagaccctcacagaacag
ggcttcatttatccaacttttgacgaaaatagttacttcacgttataa

DBGET integrated database retrieval system