KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADL176WHelp
Entry
AGOS_ADL176W      CDS       T00167                                 

Definition
ADL176Wp
Orthology
K10739  
replication factor A2
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ago00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AGOS_ADL176W
   03420 Nucleotide excision repair
    AGOS_ADL176W
   03430 Mismatch repair
    AGOS_ADL176W
   03440 Homologous recombination
    AGOS_ADL176W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV:join(386736..386742,386801..387621)
Genome map
AA seq 275 aa AA seqDB search
MATYQQPFNEFSTVTGGGFDSQASAGRPGSTGGQSTATLTPVTIKQILEAKQQVQDGPYV
VHSMELHNICFVGVVRNVVDNTANVNVTVEDGTGQIEFRQWSNDQKDMERASQGETAEYN
SELSQQFQIGNYVKVFATLREFGGKMNIQYALVKPVENFNEVLAHHLAAIKCYALANGRL
APPAAPFNAAAGAQGGQSLFVQDNDYSSAKPATQRILDFCRDQCKDKDANTFSVHTKFIA
QSLSMLEDDVRMHCQTLTEQGFIYPTFDENSYFTL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggccacataccagcaacctttcaacgagttctctacggtaaccggaggagggtttgat
tcgcaggcgtcagccgggcggcccgggtccacaggcggccagtcaaccgcgactctgacc
ccggtgacaatcaaacagatactagaagccaagcaacaggtgcaggatggcccatacgtg
gtgcacagcatggagctgcacaatatatgctttgtgggcgtggtgcgtaatgtggtggac
aacaccgccaatgtcaacgtgacagtggaggacggcacagggcagatagagtttcggcag
tggagcaacgaccagaaggacatggagcgcgcgagccagggcgagacggccgagtacaat
tcggaattgtcgcagcagttccagatcggcaactatgtcaaggtttttgccacattgcgc
gagttcggagggaagatgaacatccagtacgcgctggtcaagcctgtcgagaacttcaat
gaggtgctggcacaccacctcgccgccatcaagtgctacgcgctcgcaaacggccgcctg
gcgccgcctgctgctccgtttaacgccgcggccggcgcccagggcggccagagtctcttt
gtgcaggacaacgactacagcagcgccaagcctgctactcagagaatcctggacttctgc
cgcgaccaatgcaaagacaaggatgcaaacaccttctctgtgcacacaaagttcattgcc
cagtcgctgagcatgctggaggacgacgtccgcatgcactgtcagaccctcacagaacag
ggcttcatttatccaacttttgacgaaaatagttacttcacgttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system