KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADL188CHelp
Entry
AGOS_ADL188C      CDS       T00167                                 

Definition
ADL188Cp
Orthology
K03259  
translation initiation factor 4E
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ago00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AGOS_ADL188C
Translation factors [BR:ago03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    AGOS_ADL188C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV:complement(367905..368540)
Genome map
AA seq 211 aa AA seqDB search
MSVEEVTQKAQALSVGDNEERKTVLTDSKDFDLKHPLNSKWTLWYTKPPVGDNESWSDLL
RPVTSFTTVEEFWAIQNAIPKPRELPLKSDYHLFRNDIRPEWEDEANSRGGKWSFQFKVR
NPPIDDLWLRALLAVIGESIDEDESEINGVVINVRRSGFKIGLWTKSVRQAPLSKVGAKF
KAVLQLDDSDTLEFFAHSSANDKNAKPALVL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtggaagaagtgacccagaaggctcaagctttgtccgttggggacaacgaggaa
cgcaagacggtgcttacggacagcaaggactttgatttgaagcacccactgaactcgaag
tggacgctatggtacacgaagccgcctgtgggagacaacgagtcgtggtcagacctgttg
cggccggtgacgtccttcacaactgtggaggagttctgggccatccaaaacgcgattcca
aagccgcgcgagctgccattgaagtcggactaccacctgttcagaaacgacatcagacct
gaatgggaagatgaagcgaactcgcgcggcgggaagtggtcgtttcaattcaaagtgcgg
aaccctcctatagacgacttgtggctgcgggccctgttggccgtgatcggggagtcgatt
gacgaggacgaatctgagattaatggcgttgtgatcaatgtgagaagatctggattcaaa
attgggttgtggaccaagtctgtgagacaggctccgctgtctaaggtcggcgcgaagttc
aaggccgtgcttcagttggatgactccgacacgttggagttctttgcgcactcttctgct
aacgataaaaacgctaagcctgctctggttttgtaa

DBGET integrated database retrieval system